Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SZ00

Protein Details
Accession A0A317SZ00    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-59GKERGDKERKKRELGRKIKTBasic
NLS Segment(s)
PositionSequence
17-58RRNRRGIQKRKGETEGTEDKVGKGKERGDKERKKRELGRKIK
Subcellular Location(s) nucl 17, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MQGEEKVKMEKQEMVERRNRRGIQKRKGETEGTEDKVGKGKERGDKERKKRELGRKIKTANRDHWEKFLEEMGVNDSFKWVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.55
4 0.59
5 0.63
6 0.62
7 0.62
8 0.67
9 0.71
10 0.72
11 0.77
12 0.76
13 0.73
14 0.73
15 0.65
16 0.56
17 0.53
18 0.49
19 0.41
20 0.37
21 0.31
22 0.28
23 0.3
24 0.29
25 0.23
26 0.2
27 0.22
28 0.26
29 0.32
30 0.41
31 0.47
32 0.56
33 0.64
34 0.72
35 0.73
36 0.74
37 0.77
38 0.79
39 0.79
40 0.8
41 0.78
42 0.76
43 0.78
44 0.76
45 0.76
46 0.72
47 0.7
48 0.67
49 0.67
50 0.6
51 0.58
52 0.55
53 0.47
54 0.42
55 0.35
56 0.3
57 0.22
58 0.21
59 0.19
60 0.19
61 0.18
62 0.16
63 0.17