Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SRP1

Protein Details
Accession A0A317SRP1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22LSRIRENQRRSRARKREYMEDLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences LSRIRENQRRSRARKREYMEDLERRWQRCKEMGVQANAELQQAARKVIEENALLREILAEAGVSHEEAERRLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.81
4 0.77
5 0.77
6 0.74
7 0.71
8 0.65
9 0.65
10 0.64
11 0.56
12 0.55
13 0.48
14 0.44
15 0.41
16 0.42
17 0.39
18 0.43
19 0.45
20 0.42
21 0.4
22 0.37
23 0.33
24 0.3
25 0.23
26 0.14
27 0.09
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.09
34 0.11
35 0.14
36 0.12
37 0.13
38 0.15
39 0.15
40 0.15
41 0.14
42 0.12
43 0.09
44 0.08
45 0.07
46 0.05
47 0.04
48 0.06
49 0.06
50 0.06
51 0.06
52 0.09
53 0.1