Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SZ41

Protein Details
Accession A0A317SZ41   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-78LPPRKITYTRPQKRAPFPIRNPRPFAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 4, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040030  MRPL15  
IPR001995  Peptidase_A2_cat  
IPR000999  RNase_III_dom  
IPR036389  RNase_III_sf  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0004190  F:aspartic-type endopeptidase activity  
GO:0004525  F:ribonuclease III activity  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
GO:0006508  P:proteolysis  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF14622  Ribonucleas_3_3  
PROSITE View protein in PROSITE  
PS50175  ASP_PROT_RETROV  
Amino Acid Sequences MASRSSRKASTLITSPPALQYLQRLARPIVLLPPRRYIQHAAAGGGGASGYLPPRKITYTRPQKRAPFPIRNPRPFAVNDDPARLNEMYTTLLGREMGISDEVKWQAVTHKSFDHGRQPFNEKLAIYGKRVCWLHASLHLLNSPPIEDKKVYESPNFVSSLDGTPYRKPEPFSHRDYKSLVSIRDRNVRAILDPGKLVTIARLARLPDVMRWKPKDNNDLQGSGQAGVAAQALYAIVGALALQRGGDIAGSVVRERLLSSIDWLLEKSKDMES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.33
4 0.31
5 0.26
6 0.22
7 0.22
8 0.26
9 0.31
10 0.32
11 0.33
12 0.32
13 0.35
14 0.35
15 0.31
16 0.31
17 0.34
18 0.39
19 0.4
20 0.46
21 0.44
22 0.45
23 0.49
24 0.45
25 0.42
26 0.42
27 0.4
28 0.34
29 0.32
30 0.3
31 0.25
32 0.19
33 0.14
34 0.06
35 0.04
36 0.04
37 0.06
38 0.08
39 0.09
40 0.11
41 0.13
42 0.17
43 0.2
44 0.27
45 0.36
46 0.45
47 0.54
48 0.61
49 0.67
50 0.72
51 0.78
52 0.81
53 0.8
54 0.79
55 0.79
56 0.83
57 0.85
58 0.83
59 0.8
60 0.7
61 0.64
62 0.55
63 0.53
64 0.49
65 0.47
66 0.41
67 0.4
68 0.4
69 0.36
70 0.38
71 0.3
72 0.22
73 0.15
74 0.15
75 0.11
76 0.11
77 0.11
78 0.07
79 0.08
80 0.08
81 0.07
82 0.06
83 0.06
84 0.06
85 0.07
86 0.07
87 0.07
88 0.11
89 0.11
90 0.11
91 0.1
92 0.1
93 0.14
94 0.19
95 0.2
96 0.18
97 0.19
98 0.21
99 0.24
100 0.26
101 0.31
102 0.29
103 0.3
104 0.31
105 0.36
106 0.35
107 0.34
108 0.34
109 0.24
110 0.23
111 0.27
112 0.26
113 0.22
114 0.24
115 0.22
116 0.25
117 0.26
118 0.23
119 0.2
120 0.2
121 0.19
122 0.2
123 0.24
124 0.19
125 0.2
126 0.2
127 0.18
128 0.17
129 0.16
130 0.12
131 0.09
132 0.1
133 0.11
134 0.1
135 0.11
136 0.17
137 0.22
138 0.23
139 0.23
140 0.24
141 0.24
142 0.26
143 0.26
144 0.2
145 0.15
146 0.15
147 0.15
148 0.14
149 0.14
150 0.14
151 0.15
152 0.19
153 0.21
154 0.22
155 0.24
156 0.3
157 0.37
158 0.41
159 0.47
160 0.52
161 0.51
162 0.52
163 0.51
164 0.46
165 0.43
166 0.41
167 0.36
168 0.35
169 0.38
170 0.4
171 0.46
172 0.45
173 0.4
174 0.38
175 0.36
176 0.3
177 0.31
178 0.29
179 0.21
180 0.21
181 0.19
182 0.17
183 0.16
184 0.15
185 0.1
186 0.12
187 0.11
188 0.12
189 0.14
190 0.15
191 0.15
192 0.18
193 0.18
194 0.18
195 0.27
196 0.31
197 0.38
198 0.42
199 0.47
200 0.52
201 0.59
202 0.64
203 0.59
204 0.63
205 0.58
206 0.56
207 0.5
208 0.46
209 0.39
210 0.3
211 0.25
212 0.16
213 0.12
214 0.1
215 0.1
216 0.06
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.03
223 0.02
224 0.02
225 0.03
226 0.03
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.06
237 0.07
238 0.08
239 0.09
240 0.09
241 0.09
242 0.1
243 0.1
244 0.11
245 0.1
246 0.14
247 0.16
248 0.17
249 0.18
250 0.18
251 0.2
252 0.19
253 0.21