Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SBS0

Protein Details
Accession A0A317SBS0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-36IVRLKKGKKRYELACYKNKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 11.833, cyto 4.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR018023  Ribosome_mat_SBDS_CS  
IPR036786  Ribosome_mat_SBDS_N_sf  
IPR002140  Sdo1/SBDS  
IPR039100  Sdo1/SBDS-like  
IPR046928  SDO1/SBDS_C  
IPR018978  SDO1/SBDS_central  
IPR037188  Sdo1/SBDS_central_sf  
IPR019783  SDO1/SBDS_N  
Gene Ontology GO:0042256  P:cytosolic ribosome assembly  
Pfam View protein in Pfam  
PF01172  SBDS  
PF20268  SBDS_C  
PF09377  SBDS_domain_II  
PROSITE View protein in PROSITE  
PS01267  UPF0023  
Amino Acid Sequences MPINQPSNQIKLTNVAIVRLKKGKKRYELACYKNKVMEYRSGVETDLDEVLQIQQVFTNVSKGAVAPHADLQKSFGPKSTSESIILEILQKGELQVGEKERNAKLEQTHTEVISIVASKCVDPVSKRVYTPTMIEKALAELSAKKREEGEEDVPRWSGVTDKKSSKAQALEAIKALVYHQPIAIARARMRLRVVAPKRVKERVVEFIEQVEDQGYEGGDWECTAFVEPGKYKSIADLVASETRGKGRVEVIDTAVVSEGDKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.3
4 0.31
5 0.37
6 0.41
7 0.46
8 0.48
9 0.57
10 0.63
11 0.66
12 0.72
13 0.73
14 0.76
15 0.79
16 0.8
17 0.8
18 0.77
19 0.71
20 0.67
21 0.62
22 0.56
23 0.49
24 0.48
25 0.44
26 0.43
27 0.41
28 0.37
29 0.35
30 0.3
31 0.28
32 0.21
33 0.16
34 0.11
35 0.09
36 0.09
37 0.09
38 0.1
39 0.1
40 0.08
41 0.08
42 0.09
43 0.11
44 0.11
45 0.12
46 0.1
47 0.1
48 0.1
49 0.1
50 0.11
51 0.12
52 0.13
53 0.12
54 0.16
55 0.19
56 0.19
57 0.19
58 0.21
59 0.23
60 0.25
61 0.24
62 0.23
63 0.22
64 0.23
65 0.29
66 0.29
67 0.26
68 0.25
69 0.25
70 0.22
71 0.2
72 0.2
73 0.16
74 0.12
75 0.1
76 0.09
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.1
83 0.13
84 0.15
85 0.17
86 0.21
87 0.2
88 0.23
89 0.23
90 0.23
91 0.22
92 0.26
93 0.27
94 0.28
95 0.29
96 0.25
97 0.25
98 0.22
99 0.2
100 0.14
101 0.12
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.08
109 0.08
110 0.13
111 0.18
112 0.19
113 0.19
114 0.21
115 0.22
116 0.22
117 0.23
118 0.23
119 0.2
120 0.18
121 0.18
122 0.17
123 0.16
124 0.14
125 0.12
126 0.08
127 0.09
128 0.13
129 0.2
130 0.2
131 0.19
132 0.2
133 0.21
134 0.24
135 0.26
136 0.28
137 0.28
138 0.29
139 0.3
140 0.29
141 0.28
142 0.24
143 0.18
144 0.16
145 0.15
146 0.19
147 0.24
148 0.26
149 0.3
150 0.33
151 0.35
152 0.35
153 0.32
154 0.29
155 0.31
156 0.31
157 0.29
158 0.26
159 0.24
160 0.2
161 0.18
162 0.17
163 0.12
164 0.11
165 0.1
166 0.09
167 0.11
168 0.11
169 0.14
170 0.16
171 0.17
172 0.17
173 0.24
174 0.25
175 0.25
176 0.27
177 0.27
178 0.28
179 0.35
180 0.39
181 0.41
182 0.47
183 0.52
184 0.57
185 0.59
186 0.58
187 0.52
188 0.53
189 0.51
190 0.51
191 0.45
192 0.39
193 0.35
194 0.35
195 0.3
196 0.25
197 0.16
198 0.11
199 0.09
200 0.09
201 0.07
202 0.05
203 0.07
204 0.07
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.08
211 0.08
212 0.08
213 0.14
214 0.16
215 0.19
216 0.23
217 0.23
218 0.22
219 0.23
220 0.25
221 0.21
222 0.2
223 0.18
224 0.19
225 0.22
226 0.23
227 0.21
228 0.2
229 0.2
230 0.23
231 0.22
232 0.19
233 0.2
234 0.24
235 0.27
236 0.28
237 0.28
238 0.28
239 0.28
240 0.26
241 0.23
242 0.18