Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SSL2

Protein Details
Accession A0A317SSL2    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
286-320DLVPKAKEKRLPEKARKQPRPGTRRSMRDVKKENIBasic
NLS Segment(s)
PositionSequence
93-106RSLRRRAGSKRTRS
290-314KAKEKRLPEKARKQPRPGTRRSMRD
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MTAGLRSRGGGETQAPQLSECGHDRSCLDFGADRDIKCRTCWDNREILIQRLIEPFEHALGSFGVDAVAAGDAVVPSPTASTTPAERTTGRTRSLRRRAGSKRTRSESRGSTPTPKTQEAKEKTVDVGYSLRSANRTMSDHEEEECIRVQDLSLMRSRSQDSSGPVGKSIKPTPHMTGLKGGGVKWWESRGAGTHGRWGRPIGRGNERSPSVASSTSASRAKAAAPPVKKSQQKTLFSFFTPSPAGINRVPTPPSYAGNPSIPPPTTSPTSSSQKKPAVVEAVKVDLVPKAKEKRLPEKARKQPRPGTRRSMRDVKKENINYKEDSDSDVDLGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.24
4 0.24
5 0.22
6 0.23
7 0.22
8 0.23
9 0.21
10 0.23
11 0.24
12 0.27
13 0.27
14 0.23
15 0.23
16 0.2
17 0.21
18 0.29
19 0.32
20 0.28
21 0.29
22 0.33
23 0.32
24 0.31
25 0.37
26 0.33
27 0.39
28 0.46
29 0.49
30 0.53
31 0.53
32 0.61
33 0.58
34 0.54
35 0.49
36 0.43
37 0.4
38 0.34
39 0.33
40 0.24
41 0.23
42 0.2
43 0.17
44 0.16
45 0.13
46 0.12
47 0.11
48 0.11
49 0.08
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.07
68 0.09
69 0.11
70 0.16
71 0.18
72 0.2
73 0.21
74 0.26
75 0.33
76 0.36
77 0.38
78 0.41
79 0.47
80 0.55
81 0.64
82 0.66
83 0.62
84 0.67
85 0.71
86 0.75
87 0.78
88 0.77
89 0.76
90 0.76
91 0.78
92 0.72
93 0.71
94 0.66
95 0.63
96 0.59
97 0.53
98 0.54
99 0.51
100 0.54
101 0.52
102 0.5
103 0.45
104 0.44
105 0.51
106 0.48
107 0.49
108 0.44
109 0.4
110 0.37
111 0.35
112 0.3
113 0.21
114 0.18
115 0.14
116 0.13
117 0.13
118 0.13
119 0.13
120 0.13
121 0.13
122 0.15
123 0.15
124 0.16
125 0.21
126 0.23
127 0.23
128 0.23
129 0.23
130 0.2
131 0.2
132 0.18
133 0.13
134 0.1
135 0.09
136 0.08
137 0.1
138 0.11
139 0.12
140 0.14
141 0.15
142 0.16
143 0.18
144 0.2
145 0.17
146 0.18
147 0.19
148 0.18
149 0.21
150 0.24
151 0.22
152 0.22
153 0.23
154 0.22
155 0.24
156 0.24
157 0.22
158 0.22
159 0.24
160 0.25
161 0.32
162 0.32
163 0.29
164 0.3
165 0.27
166 0.26
167 0.24
168 0.21
169 0.15
170 0.14
171 0.14
172 0.12
173 0.12
174 0.11
175 0.1
176 0.11
177 0.11
178 0.15
179 0.18
180 0.17
181 0.23
182 0.26
183 0.26
184 0.26
185 0.26
186 0.25
187 0.27
188 0.32
189 0.3
190 0.37
191 0.41
192 0.41
193 0.45
194 0.43
195 0.39
196 0.34
197 0.3
198 0.22
199 0.19
200 0.18
201 0.14
202 0.14
203 0.17
204 0.18
205 0.17
206 0.16
207 0.16
208 0.17
209 0.18
210 0.24
211 0.26
212 0.27
213 0.31
214 0.37
215 0.45
216 0.49
217 0.49
218 0.53
219 0.56
220 0.59
221 0.6
222 0.6
223 0.54
224 0.49
225 0.5
226 0.39
227 0.33
228 0.28
229 0.23
230 0.18
231 0.17
232 0.21
233 0.18
234 0.23
235 0.22
236 0.24
237 0.25
238 0.23
239 0.28
240 0.26
241 0.26
242 0.25
243 0.26
244 0.26
245 0.28
246 0.28
247 0.25
248 0.27
249 0.26
250 0.25
251 0.24
252 0.25
253 0.26
254 0.27
255 0.29
256 0.31
257 0.39
258 0.44
259 0.46
260 0.51
261 0.52
262 0.55
263 0.53
264 0.51
265 0.51
266 0.46
267 0.44
268 0.38
269 0.35
270 0.31
271 0.29
272 0.25
273 0.18
274 0.2
275 0.19
276 0.24
277 0.29
278 0.35
279 0.41
280 0.49
281 0.56
282 0.65
283 0.73
284 0.76
285 0.8
286 0.85
287 0.9
288 0.92
289 0.91
290 0.89
291 0.89
292 0.88
293 0.86
294 0.86
295 0.84
296 0.83
297 0.82
298 0.83
299 0.81
300 0.82
301 0.81
302 0.78
303 0.79
304 0.79
305 0.8
306 0.77
307 0.73
308 0.66
309 0.61
310 0.59
311 0.49
312 0.44
313 0.38
314 0.31