Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SS33

Protein Details
Accession A0A317SS33   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-89GLEVEKRRCTHCRRNKPLQEFDQNRQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.333, nucl 14, cyto 9.5, mito_nucl 9.165
Family & Domain DBs
Amino Acid Sequences MEKDYKESCGVLNLVMGKTKDENRDELPQQVEGIEGGLPGSSLLEGRVHVLEEEVAIEPHRVHGLEVEKRRCTHCRRNKPLQEFDQNRQGNIYKTCPSCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.19
4 0.17
5 0.2
6 0.25
7 0.29
8 0.29
9 0.32
10 0.33
11 0.4
12 0.4
13 0.4
14 0.37
15 0.31
16 0.28
17 0.24
18 0.2
19 0.12
20 0.11
21 0.07
22 0.05
23 0.04
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.06
41 0.05
42 0.05
43 0.05
44 0.06
45 0.05
46 0.06
47 0.07
48 0.06
49 0.06
50 0.1
51 0.15
52 0.22
53 0.3
54 0.35
55 0.38
56 0.39
57 0.44
58 0.48
59 0.51
60 0.55
61 0.59
62 0.65
63 0.71
64 0.8
65 0.86
66 0.87
67 0.88
68 0.85
69 0.85
70 0.8
71 0.76
72 0.75
73 0.66
74 0.57
75 0.52
76 0.46
77 0.41
78 0.39
79 0.39
80 0.36