Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SP71

Protein Details
Accession A0A317SP71    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
87-123NERTDERRSKRLPQPKPERKAKVRSERKDYTRNKAHCBasic
NLS Segment(s)
PositionSequence
93-114RRSKRLPQPKPERKAKVRSERK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
Amino Acid Sequences YIPYQWHKSYSQEQSHRHSQPATNPSAPHLQASHLPTLRQPLSSPSPLSHFQHFPPPPATPTAIPYAKPPHLPFSTSRIYPSSRILNERTDERRSKRLPQPKPERKAKVRSERKDYTRNKAHCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.72
3 0.68
4 0.63
5 0.57
6 0.51
7 0.51
8 0.52
9 0.51
10 0.45
11 0.42
12 0.42
13 0.44
14 0.41
15 0.33
16 0.27
17 0.22
18 0.24
19 0.27
20 0.31
21 0.25
22 0.25
23 0.24
24 0.3
25 0.29
26 0.25
27 0.22
28 0.21
29 0.25
30 0.27
31 0.28
32 0.22
33 0.25
34 0.28
35 0.3
36 0.28
37 0.25
38 0.23
39 0.32
40 0.32
41 0.3
42 0.29
43 0.27
44 0.25
45 0.25
46 0.25
47 0.16
48 0.18
49 0.2
50 0.18
51 0.17
52 0.19
53 0.23
54 0.23
55 0.25
56 0.24
57 0.25
58 0.26
59 0.27
60 0.26
61 0.27
62 0.29
63 0.27
64 0.27
65 0.24
66 0.25
67 0.25
68 0.27
69 0.28
70 0.27
71 0.3
72 0.31
73 0.33
74 0.33
75 0.38
76 0.39
77 0.39
78 0.44
79 0.46
80 0.53
81 0.52
82 0.59
83 0.63
84 0.68
85 0.7
86 0.74
87 0.8
88 0.81
89 0.87
90 0.88
91 0.88
92 0.87
93 0.88
94 0.87
95 0.87
96 0.87
97 0.87
98 0.86
99 0.86
100 0.85
101 0.85
102 0.82
103 0.81
104 0.81