Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SCY9

Protein Details
Accession A0A317SCY9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-44EHEDIKAKPKRRVREDKKFKKFKSDQRTSQSNSBasic
NLS Segment(s)
PositionSequence
17-34KAKPKRRVREDKKFKKFK
Subcellular Location(s) nucl 17, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MGLGSEKEEDFEHEDIKAKPKRRVREDKKFKKFKSDQRTSQSNSLPAVLRTLSLKAGKDTAGERSIKKVQVKGKDGYLVTKLEPAWESFSEEEPAPKGKKKSAGPGTGQGSINSYFFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.31
4 0.34
5 0.36
6 0.44
7 0.51
8 0.61
9 0.67
10 0.77
11 0.78
12 0.83
13 0.88
14 0.9
15 0.93
16 0.93
17 0.84
18 0.84
19 0.83
20 0.81
21 0.81
22 0.8
23 0.77
24 0.75
25 0.8
26 0.73
27 0.71
28 0.63
29 0.54
30 0.45
31 0.39
32 0.32
33 0.24
34 0.22
35 0.15
36 0.12
37 0.11
38 0.11
39 0.11
40 0.12
41 0.13
42 0.12
43 0.13
44 0.12
45 0.13
46 0.13
47 0.13
48 0.14
49 0.16
50 0.15
51 0.19
52 0.23
53 0.26
54 0.28
55 0.3
56 0.33
57 0.4
58 0.44
59 0.41
60 0.39
61 0.39
62 0.37
63 0.34
64 0.3
65 0.23
66 0.19
67 0.2
68 0.18
69 0.15
70 0.16
71 0.15
72 0.17
73 0.16
74 0.19
75 0.17
76 0.19
77 0.19
78 0.19
79 0.19
80 0.17
81 0.22
82 0.22
83 0.27
84 0.29
85 0.32
86 0.4
87 0.44
88 0.53
89 0.56
90 0.6
91 0.59
92 0.63
93 0.62
94 0.6
95 0.56
96 0.45
97 0.39
98 0.33
99 0.3