Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317T1L9

Protein Details
Accession A0A317T1L9    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-46DLPAPTAQPPTRKRKRPKKTDDDTPKEFTRHydrophilic
NLS Segment(s)
PositionSequence
27-35TRKRKRPKK
112-119KEKKEKAK
138-152EGGARRKRGRNKGRA
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPNKKGRNKNLPGIEYDLPAPTAQPPTRKRKRPKKTDDDTPKEFTRLLSRVQQNKPKPNGLDDPPTKARKPHPIPELKIQPSESLRQFNRRVNTSLPITLKPEGNSKAQSAKEKKEKAKSILASDGGGGEGEDRSGEEGGARRKRGRNKGRAVSPDPWAALMEKRRVTKFSDLATAPPVLVKPKIVLHSRGVVDVEGVPKSSGSLARREGLAEERRGIVEGYRRLVEERRGGKGLETNWGAGERKTGRFIWYDSTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.48
3 0.42
4 0.33
5 0.25
6 0.22
7 0.19
8 0.15
9 0.22
10 0.23
11 0.32
12 0.39
13 0.49
14 0.6
15 0.7
16 0.78
17 0.81
18 0.89
19 0.91
20 0.93
21 0.93
22 0.92
23 0.93
24 0.93
25 0.9
26 0.85
27 0.8
28 0.71
29 0.62
30 0.54
31 0.44
32 0.41
33 0.35
34 0.32
35 0.35
36 0.41
37 0.49
38 0.57
39 0.65
40 0.65
41 0.73
42 0.75
43 0.73
44 0.66
45 0.63
46 0.61
47 0.56
48 0.57
49 0.49
50 0.51
51 0.52
52 0.55
53 0.5
54 0.48
55 0.49
56 0.5
57 0.55
58 0.56
59 0.59
60 0.63
61 0.66
62 0.7
63 0.73
64 0.65
65 0.61
66 0.53
67 0.47
68 0.41
69 0.42
70 0.36
71 0.34
72 0.33
73 0.38
74 0.43
75 0.44
76 0.47
77 0.45
78 0.45
79 0.39
80 0.42
81 0.36
82 0.36
83 0.33
84 0.29
85 0.29
86 0.28
87 0.27
88 0.23
89 0.26
90 0.24
91 0.24
92 0.24
93 0.23
94 0.26
95 0.27
96 0.35
97 0.35
98 0.4
99 0.46
100 0.52
101 0.57
102 0.6
103 0.63
104 0.59
105 0.61
106 0.55
107 0.49
108 0.44
109 0.38
110 0.3
111 0.24
112 0.2
113 0.12
114 0.1
115 0.07
116 0.04
117 0.03
118 0.03
119 0.03
120 0.03
121 0.04
122 0.04
123 0.04
124 0.05
125 0.08
126 0.16
127 0.2
128 0.23
129 0.27
130 0.33
131 0.42
132 0.52
133 0.59
134 0.62
135 0.67
136 0.73
137 0.75
138 0.76
139 0.72
140 0.64
141 0.57
142 0.49
143 0.4
144 0.32
145 0.26
146 0.2
147 0.18
148 0.2
149 0.22
150 0.24
151 0.28
152 0.29
153 0.3
154 0.34
155 0.37
156 0.36
157 0.33
158 0.34
159 0.31
160 0.31
161 0.31
162 0.27
163 0.2
164 0.16
165 0.15
166 0.12
167 0.12
168 0.11
169 0.11
170 0.15
171 0.21
172 0.23
173 0.26
174 0.26
175 0.32
176 0.32
177 0.31
178 0.28
179 0.22
180 0.2
181 0.18
182 0.17
183 0.12
184 0.12
185 0.1
186 0.1
187 0.1
188 0.11
189 0.14
190 0.14
191 0.2
192 0.22
193 0.24
194 0.24
195 0.24
196 0.24
197 0.27
198 0.31
199 0.28
200 0.27
201 0.27
202 0.27
203 0.27
204 0.25
205 0.21
206 0.23
207 0.25
208 0.26
209 0.26
210 0.27
211 0.29
212 0.33
213 0.36
214 0.37
215 0.38
216 0.4
217 0.4
218 0.4
219 0.4
220 0.41
221 0.36
222 0.35
223 0.32
224 0.27
225 0.26
226 0.29
227 0.28
228 0.23
229 0.29
230 0.26
231 0.28
232 0.32
233 0.32
234 0.32
235 0.34
236 0.36