Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SHQ7

Protein Details
Accession A0A317SHQ7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-31IPWNPGPNWKPPHRRTKTLKQILSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MILVAQTIPWNPGPNWKPPHRRTKTLKQILSDATRTAAAGEGGTVPATGPMQTTYANIESAPSLHPAHSKKWCDITGLPAKYTDPKTKLRYADKEVYAAIRMLPPGSAERYLELRGANVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.52
4 0.6
5 0.65
6 0.76
7 0.73
8 0.8
9 0.8
10 0.83
11 0.85
12 0.84
13 0.8
14 0.71
15 0.68
16 0.64
17 0.6
18 0.5
19 0.39
20 0.3
21 0.26
22 0.23
23 0.18
24 0.13
25 0.08
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.04
33 0.04
34 0.05
35 0.04
36 0.05
37 0.05
38 0.06
39 0.07
40 0.07
41 0.09
42 0.09
43 0.09
44 0.09
45 0.08
46 0.07
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.13
53 0.15
54 0.21
55 0.28
56 0.3
57 0.29
58 0.34
59 0.34
60 0.33
61 0.32
62 0.34
63 0.36
64 0.34
65 0.32
66 0.28
67 0.28
68 0.3
69 0.34
70 0.34
71 0.29
72 0.36
73 0.41
74 0.47
75 0.54
76 0.57
77 0.59
78 0.6
79 0.63
80 0.57
81 0.53
82 0.48
83 0.42
84 0.34
85 0.27
86 0.21
87 0.14
88 0.13
89 0.11
90 0.11
91 0.11
92 0.13
93 0.16
94 0.17
95 0.16
96 0.18
97 0.21
98 0.22
99 0.23
100 0.2
101 0.17
102 0.17