Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SDF1

Protein Details
Accession A0A317SDF1   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-124GRVLRKRAANIQRPTRRKKNLRRKNPRNGKRKRKPRKEFFBasic
NLS Segment(s)
PositionSequence
81-122RFEEGRVLRKRAANIQRPTRRKKNLRRKNPRNGKRKRKPRKE
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 6
Family & Domain DBs
Amino Acid Sequences SSPIPLQSSIMPPKRMTANPTKPLRYRPGKPIAPEESDSEESEGSEAEESEEEPQQPSKRATSEAPAKVSTALKKVDLSKRFEEGRVLRKRAANIQRPTRRKKNLRRKNPRNGKRKRKPRKEFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.45
4 0.46
5 0.5
6 0.56
7 0.63
8 0.65
9 0.63
10 0.67
11 0.7
12 0.68
13 0.63
14 0.64
15 0.66
16 0.64
17 0.63
18 0.64
19 0.59
20 0.55
21 0.51
22 0.44
23 0.4
24 0.38
25 0.35
26 0.28
27 0.23
28 0.18
29 0.17
30 0.13
31 0.08
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.07
38 0.08
39 0.08
40 0.09
41 0.12
42 0.12
43 0.15
44 0.16
45 0.16
46 0.17
47 0.19
48 0.19
49 0.22
50 0.28
51 0.29
52 0.29
53 0.28
54 0.27
55 0.27
56 0.28
57 0.24
58 0.19
59 0.17
60 0.16
61 0.18
62 0.24
63 0.3
64 0.33
65 0.37
66 0.36
67 0.4
68 0.4
69 0.39
70 0.4
71 0.37
72 0.42
73 0.45
74 0.46
75 0.45
76 0.47
77 0.49
78 0.52
79 0.56
80 0.56
81 0.56
82 0.64
83 0.7
84 0.75
85 0.82
86 0.83
87 0.84
88 0.85
89 0.88
90 0.88
91 0.89
92 0.92
93 0.94
94 0.95
95 0.95
96 0.96
97 0.95
98 0.94
99 0.94
100 0.94
101 0.94
102 0.95
103 0.95
104 0.95