Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SXC3

Protein Details
Accession A0A317SXC3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPALEKPKCARRQKPPEAKARSQKRSEHydrophilic
NLS Segment(s)
PositionSequence
11-22RRQKPPEAKARS
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MPALEKPKCARRQKPPEAKARSQKRSEQRTIVPACRAASRNFQHCAELQETPGDSGELQENPGDCGGLWGTAEDHQGLWETVGDCGRPPRTMGDCGGLWEDYGVPNLIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.89
4 0.88
5 0.87
6 0.86
7 0.86
8 0.84
9 0.78
10 0.79
11 0.79
12 0.79
13 0.76
14 0.72
15 0.66
16 0.66
17 0.66
18 0.6
19 0.53
20 0.46
21 0.4
22 0.38
23 0.36
24 0.29
25 0.33
26 0.33
27 0.36
28 0.36
29 0.36
30 0.33
31 0.32
32 0.33
33 0.26
34 0.22
35 0.17
36 0.15
37 0.15
38 0.13
39 0.12
40 0.09
41 0.06
42 0.06
43 0.07
44 0.06
45 0.07
46 0.07
47 0.07
48 0.08
49 0.08
50 0.07
51 0.05
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.06
58 0.07
59 0.08
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.07
66 0.08
67 0.08
68 0.09
69 0.1
70 0.1
71 0.1
72 0.15
73 0.17
74 0.16
75 0.17
76 0.22
77 0.25
78 0.28
79 0.29
80 0.29
81 0.27
82 0.28
83 0.29
84 0.23
85 0.19
86 0.16
87 0.15
88 0.11
89 0.12