Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XZ74

Protein Details
Accession A0A317XZ74    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-93ELIRNSKDKRARKFIKRRIGTLRRBasic
NLS Segment(s)
PositionSequence
36-46RPSNRKGRQGE
73-97RNSKDKRARKFIKRRIGTLRRAKGK
Subcellular Location(s) mito 16, cyto 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MGNSSNPAHKAGVPRSGLVWGINRGHQTERRVLAPRPSNRKGRQGERVKVIRSVIREVAGFAPYERRAMELIRNSKDKRARKFIKRRIGTLRRAKGKMEMLTNVIAEQRRAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.33
4 0.3
5 0.24
6 0.23
7 0.2
8 0.2
9 0.22
10 0.23
11 0.24
12 0.28
13 0.31
14 0.32
15 0.34
16 0.34
17 0.36
18 0.39
19 0.38
20 0.42
21 0.46
22 0.5
23 0.53
24 0.56
25 0.62
26 0.62
27 0.69
28 0.68
29 0.66
30 0.68
31 0.68
32 0.68
33 0.66
34 0.67
35 0.58
36 0.53
37 0.48
38 0.4
39 0.33
40 0.3
41 0.23
42 0.19
43 0.17
44 0.16
45 0.15
46 0.13
47 0.11
48 0.08
49 0.11
50 0.11
51 0.12
52 0.11
53 0.11
54 0.11
55 0.12
56 0.18
57 0.21
58 0.28
59 0.31
60 0.37
61 0.37
62 0.44
63 0.51
64 0.54
65 0.55
66 0.59
67 0.65
68 0.7
69 0.8
70 0.83
71 0.85
72 0.82
73 0.8
74 0.8
75 0.8
76 0.79
77 0.78
78 0.78
79 0.76
80 0.73
81 0.68
82 0.64
83 0.62
84 0.57
85 0.51
86 0.44
87 0.38
88 0.38
89 0.36
90 0.3
91 0.26
92 0.23
93 0.18