Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LBT9

Protein Details
Accession E2LBT9   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
163-188TDSTSIRVSRHHRKPRPTPIPIKDTKHydrophilic
NLS Segment(s)
PositionSequence
172-179RHHRKPRP
Subcellular Location(s) nucl 15, mito 7, cyto 4
Family & Domain DBs
KEGG mpr:MPER_03630  -  
Amino Acid Sequences MLKQERGISQQLGKVNGFAVGIPIRAKLIKDLDFAWVAFTESVDEPWYPRLFCELLLTVTPIYSSFCKRFPALPFPDNIAKCFPSDDLRDEWMLEKDYQVFEHLMYTSSLAELLQEYRAARMPLVLAPSVSPYTSTKTTRKRGCSPVGVSESASVAAKKKKDTDSTSIRVSRHHRKPRPTPIPIKDTKGSANLMIKKEKVNVSSCCIHPFATEGFGPSYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.24
4 0.2
5 0.15
6 0.14
7 0.12
8 0.13
9 0.13
10 0.13
11 0.13
12 0.15
13 0.15
14 0.17
15 0.22
16 0.23
17 0.24
18 0.25
19 0.26
20 0.26
21 0.25
22 0.22
23 0.16
24 0.15
25 0.13
26 0.12
27 0.11
28 0.1
29 0.11
30 0.11
31 0.11
32 0.11
33 0.16
34 0.18
35 0.15
36 0.15
37 0.18
38 0.17
39 0.17
40 0.2
41 0.17
42 0.16
43 0.17
44 0.18
45 0.13
46 0.13
47 0.12
48 0.09
49 0.09
50 0.1
51 0.14
52 0.16
53 0.18
54 0.21
55 0.22
56 0.27
57 0.3
58 0.37
59 0.39
60 0.38
61 0.37
62 0.39
63 0.44
64 0.4
65 0.36
66 0.3
67 0.24
68 0.22
69 0.22
70 0.19
71 0.16
72 0.18
73 0.19
74 0.19
75 0.2
76 0.2
77 0.19
78 0.19
79 0.17
80 0.17
81 0.14
82 0.12
83 0.11
84 0.12
85 0.11
86 0.11
87 0.1
88 0.08
89 0.09
90 0.08
91 0.08
92 0.07
93 0.08
94 0.06
95 0.06
96 0.06
97 0.05
98 0.05
99 0.04
100 0.05
101 0.04
102 0.06
103 0.06
104 0.07
105 0.09
106 0.09
107 0.08
108 0.08
109 0.08
110 0.09
111 0.1
112 0.09
113 0.08
114 0.08
115 0.1
116 0.1
117 0.09
118 0.09
119 0.09
120 0.13
121 0.17
122 0.21
123 0.27
124 0.36
125 0.45
126 0.51
127 0.57
128 0.61
129 0.65
130 0.66
131 0.66
132 0.6
133 0.58
134 0.54
135 0.48
136 0.4
137 0.33
138 0.27
139 0.21
140 0.18
141 0.12
142 0.12
143 0.16
144 0.18
145 0.21
146 0.27
147 0.32
148 0.39
149 0.44
150 0.48
151 0.52
152 0.54
153 0.58
154 0.57
155 0.52
156 0.51
157 0.53
158 0.55
159 0.58
160 0.64
161 0.65
162 0.71
163 0.81
164 0.86
165 0.88
166 0.87
167 0.86
168 0.83
169 0.84
170 0.79
171 0.75
172 0.67
173 0.59
174 0.53
175 0.47
176 0.4
177 0.36
178 0.39
179 0.39
180 0.41
181 0.43
182 0.42
183 0.41
184 0.45
185 0.45
186 0.42
187 0.42
188 0.41
189 0.42
190 0.46
191 0.44
192 0.42
193 0.39
194 0.35
195 0.29
196 0.28
197 0.24
198 0.21
199 0.2
200 0.18