Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XIW7

Protein Details
Accession A0A317XIW7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MTRTRHGKKTHHARRDVKRAMRTRARKLDPBasic
NLS Segment(s)
PositionSequence
5-27RHGKKTHHARRDVKRAMRTRARK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MTRTRHGKKTHHARRDVKRAMRTRARKLDPDQIQANLNDPKKLDALQNPQQLDVDKAGLGLFYCVECDRNFPSQKDQLTHIASKLHKRVAKKIHDEQAYTVEESLRAAGIGVDNQQRRPQDMATKPRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.88
4 0.85
5 0.84
6 0.82
7 0.82
8 0.83
9 0.81
10 0.8
11 0.81
12 0.78
13 0.76
14 0.73
15 0.73
16 0.68
17 0.66
18 0.58
19 0.49
20 0.46
21 0.39
22 0.38
23 0.34
24 0.3
25 0.26
26 0.23
27 0.23
28 0.22
29 0.23
30 0.22
31 0.22
32 0.29
33 0.35
34 0.4
35 0.39
36 0.38
37 0.38
38 0.34
39 0.29
40 0.22
41 0.14
42 0.09
43 0.08
44 0.08
45 0.07
46 0.06
47 0.05
48 0.04
49 0.03
50 0.04
51 0.04
52 0.06
53 0.06
54 0.08
55 0.11
56 0.18
57 0.21
58 0.21
59 0.27
60 0.31
61 0.34
62 0.33
63 0.33
64 0.32
65 0.33
66 0.32
67 0.28
68 0.28
69 0.28
70 0.33
71 0.34
72 0.35
73 0.34
74 0.37
75 0.44
76 0.48
77 0.55
78 0.57
79 0.61
80 0.63
81 0.63
82 0.62
83 0.54
84 0.51
85 0.44
86 0.36
87 0.29
88 0.2
89 0.17
90 0.16
91 0.15
92 0.09
93 0.06
94 0.06
95 0.06
96 0.06
97 0.08
98 0.11
99 0.18
100 0.21
101 0.24
102 0.29
103 0.3
104 0.33
105 0.35
106 0.36
107 0.39
108 0.46