Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XUM7

Protein Details
Accession A0A317XUM7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-33STQAAKRTTKSKKDPEAPKRPLSHydrophilic
NLS Segment(s)
PositionSequence
20-23KSKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAHRETKSKSSTQAAKRTTKSKKDPEAPKRPLSAYMFFSQDHRERVKAANPEAGFGDVGRLLGAKWKEMSDAEKKPYNDMANRDKARAEAEKAAYHKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.67
4 0.72
5 0.73
6 0.73
7 0.74
8 0.75
9 0.78
10 0.79
11 0.84
12 0.85
13 0.87
14 0.84
15 0.79
16 0.73
17 0.64
18 0.6
19 0.54
20 0.47
21 0.39
22 0.34
23 0.31
24 0.27
25 0.28
26 0.27
27 0.26
28 0.26
29 0.24
30 0.22
31 0.22
32 0.25
33 0.29
34 0.28
35 0.26
36 0.28
37 0.26
38 0.26
39 0.24
40 0.22
41 0.17
42 0.12
43 0.11
44 0.06
45 0.06
46 0.05
47 0.05
48 0.04
49 0.09
50 0.09
51 0.1
52 0.11
53 0.11
54 0.13
55 0.14
56 0.19
57 0.23
58 0.28
59 0.32
60 0.37
61 0.37
62 0.39
63 0.44
64 0.44
65 0.41
66 0.43
67 0.47
68 0.51
69 0.53
70 0.51
71 0.46
72 0.42
73 0.42
74 0.4
75 0.36
76 0.33
77 0.35
78 0.4