Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CH17

Protein Details
Accession A1CH17   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
75-104IENVKKEYEEKQRRKKEKEKEKGKGKGKEDBasic
NLS Segment(s)
PositionSequence
82-105YEEKQRRKKEKEKEKGKGKGKEDK
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
KEGG act:ACLA_046380  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSLQNVWHLRRVAETAARACIICYKPSSSVLITPDNKDFFYVCPVHLQDRHFCSPIVDAEEAEAKKKQEALAREIENVKKEYEEKQRRKKEKEKEKGKGKGKEDKTDEKDQDKESKKSGQDGDNEAKSMETERDEKIESIKKAASPSATDDSPRIFTLHKNFYQMRIDRLRGLEMAKRNRQRLQDPSLFPAVPSGDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.32
4 0.32
5 0.29
6 0.26
7 0.29
8 0.26
9 0.24
10 0.24
11 0.25
12 0.27
13 0.29
14 0.32
15 0.26
16 0.28
17 0.28
18 0.34
19 0.33
20 0.34
21 0.37
22 0.35
23 0.33
24 0.3
25 0.27
26 0.2
27 0.24
28 0.22
29 0.18
30 0.22
31 0.23
32 0.27
33 0.3
34 0.32
35 0.32
36 0.37
37 0.41
38 0.36
39 0.35
40 0.31
41 0.29
42 0.28
43 0.26
44 0.19
45 0.15
46 0.15
47 0.2
48 0.19
49 0.19
50 0.19
51 0.15
52 0.16
53 0.18
54 0.2
55 0.19
56 0.22
57 0.25
58 0.3
59 0.31
60 0.32
61 0.35
62 0.34
63 0.31
64 0.29
65 0.25
66 0.19
67 0.19
68 0.23
69 0.31
70 0.4
71 0.47
72 0.57
73 0.67
74 0.74
75 0.82
76 0.84
77 0.84
78 0.84
79 0.85
80 0.85
81 0.84
82 0.85
83 0.85
84 0.85
85 0.82
86 0.76
87 0.75
88 0.68
89 0.66
90 0.62
91 0.62
92 0.59
93 0.6
94 0.58
95 0.52
96 0.51
97 0.46
98 0.5
99 0.46
100 0.42
101 0.38
102 0.41
103 0.38
104 0.4
105 0.41
106 0.37
107 0.35
108 0.39
109 0.41
110 0.35
111 0.34
112 0.29
113 0.25
114 0.2
115 0.18
116 0.13
117 0.1
118 0.12
119 0.13
120 0.15
121 0.16
122 0.16
123 0.21
124 0.26
125 0.24
126 0.25
127 0.26
128 0.26
129 0.26
130 0.28
131 0.24
132 0.19
133 0.23
134 0.24
135 0.23
136 0.23
137 0.22
138 0.23
139 0.23
140 0.22
141 0.18
142 0.15
143 0.2
144 0.27
145 0.34
146 0.34
147 0.38
148 0.39
149 0.43
150 0.51
151 0.47
152 0.47
153 0.46
154 0.46
155 0.44
156 0.44
157 0.42
158 0.35
159 0.36
160 0.34
161 0.36
162 0.43
163 0.49
164 0.55
165 0.59
166 0.63
167 0.68
168 0.69
169 0.69
170 0.68
171 0.68
172 0.63
173 0.63
174 0.62
175 0.55
176 0.47
177 0.42