Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XSX6

Protein Details
Accession A0A317XSX6   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRRTYCKGKPCKKHTPHKITQYKTGKHydrophilic
NLS Segment(s)
PositionSequence
41-49RRYDRKQKG
55-56KP
58-63FHKKAK
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKGKPCKKHTPHKITQYKTGKASLYAQGKRRYDRKQKGYGGQTKPVFHKKAKTTKKVVLRLECTQCKYRSHVALKRCKHFELGGDKKQKNAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.85
4 0.9
5 0.89
6 0.9
7 0.9
8 0.89
9 0.88
10 0.89
11 0.89
12 0.82
13 0.82
14 0.79
15 0.73
16 0.65
17 0.6
18 0.49
19 0.42
20 0.41
21 0.38
22 0.38
23 0.38
24 0.42
25 0.46
26 0.48
27 0.52
28 0.56
29 0.58
30 0.61
31 0.66
32 0.68
33 0.69
34 0.71
35 0.73
36 0.75
37 0.74
38 0.66
39 0.64
40 0.58
41 0.51
42 0.5
43 0.5
44 0.45
45 0.38
46 0.42
47 0.43
48 0.51
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.63
58 0.63
59 0.65
60 0.62
61 0.57
62 0.56
63 0.52
64 0.47
65 0.47
66 0.47
67 0.47
68 0.52
69 0.53
70 0.56
71 0.64
72 0.69
73 0.72
74 0.7
75 0.63
76 0.57
77 0.53
78 0.51
79 0.52
80 0.53
81 0.54
82 0.59
83 0.58
84 0.58
85 0.61
86 0.56