Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XMK5

Protein Details
Accession A0A317XMK5   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-49DMPKRALSHCRGKRRRERERILDYCSBasic
NLS Segment(s)
PositionSequence
36-39KRRR
Subcellular Location(s) nucl 11, mito 6, cyto 4, plas 4
Family & Domain DBs
Amino Acid Sequences MCVHLCVCVHVSLVWRLAGCMQIDMPKRALSHCRGKRRRERERILDYCSTSVCVCVSESMIIWHGLCSLSRDQFDLHNSALGASQYRKYCTQDCTAPYSTVQYSSTVVVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.16
4 0.16
5 0.18
6 0.15
7 0.13
8 0.12
9 0.17
10 0.21
11 0.22
12 0.23
13 0.22
14 0.22
15 0.24
16 0.29
17 0.3
18 0.37
19 0.44
20 0.53
21 0.59
22 0.69
23 0.77
24 0.81
25 0.86
26 0.86
27 0.86
28 0.85
29 0.86
30 0.8
31 0.75
32 0.68
33 0.58
34 0.48
35 0.39
36 0.31
37 0.2
38 0.17
39 0.11
40 0.08
41 0.07
42 0.06
43 0.07
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.09
55 0.1
56 0.13
57 0.13
58 0.14
59 0.14
60 0.16
61 0.19
62 0.19
63 0.16
64 0.15
65 0.15
66 0.14
67 0.14
68 0.12
69 0.12
70 0.11
71 0.16
72 0.17
73 0.2
74 0.23
75 0.27
76 0.31
77 0.33
78 0.37
79 0.39
80 0.4
81 0.44
82 0.44
83 0.4
84 0.37
85 0.37
86 0.32
87 0.28
88 0.26
89 0.21
90 0.19
91 0.2