Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CPB7

Protein Details
Accession A1CPB7   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-45LKGLKTSDGRVDKKKKKKKAKNVDTEALAHydrophilic
NLS Segment(s)
PositionSequence
13-37GKLKLKGLKTSDGRVDKKKKKKKAK
89-104ARKKRLLERLKREGVK
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG act:ACLA_022020  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAPGDEYAAGGGGKLKLKGLKTSDGRVDKKKKKKKAKNVDTEALASPAAAATSEDAEQRSRSRSEEQHSGEYDAAGVGKTEAERKYEEARKKRLLERLKREGVKTHKERVEELNKYLSRLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.19
4 0.21
5 0.28
6 0.3
7 0.36
8 0.38
9 0.43
10 0.49
11 0.53
12 0.57
13 0.61
14 0.67
15 0.68
16 0.76
17 0.8
18 0.82
19 0.85
20 0.9
21 0.92
22 0.92
23 0.93
24 0.93
25 0.91
26 0.86
27 0.76
28 0.68
29 0.57
30 0.46
31 0.35
32 0.24
33 0.15
34 0.1
35 0.07
36 0.05
37 0.04
38 0.03
39 0.05
40 0.05
41 0.06
42 0.07
43 0.08
44 0.09
45 0.11
46 0.13
47 0.13
48 0.15
49 0.2
50 0.23
51 0.27
52 0.34
53 0.35
54 0.36
55 0.36
56 0.35
57 0.3
58 0.25
59 0.2
60 0.12
61 0.09
62 0.06
63 0.05
64 0.03
65 0.04
66 0.04
67 0.08
68 0.09
69 0.11
70 0.13
71 0.16
72 0.23
73 0.31
74 0.4
75 0.44
76 0.51
77 0.57
78 0.61
79 0.65
80 0.66
81 0.69
82 0.7
83 0.72
84 0.73
85 0.74
86 0.73
87 0.69
88 0.68
89 0.66
90 0.66
91 0.63
92 0.62
93 0.58
94 0.56
95 0.57
96 0.57
97 0.59
98 0.52
99 0.49
100 0.5
101 0.46
102 0.46
103 0.44
104 0.37
105 0.31
106 0.28
107 0.31
108 0.3
109 0.32
110 0.38
111 0.42
112 0.42