Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XIF0

Protein Details
Accession A0A317XIF0   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
211-239STKSTKSTKLTDRPTNQRDPRAKNKIKWKHydrophilic
NLS Segment(s)
PositionSequence
109-148GVRPRKSTTKKTKRMGWSEHTRAPSGANESKAKERRGGKK
230-239PRAKNKIKWK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MQYSSCVCARTATREGEHATPTSQPTKRARKAGYRVGCSAVRSVVGWRTRPSATKRKSTLSATAGEGGVETELDRKCSAEPSQQESRIKNQGWDRIMQGKNAQARLEPGVRPRKSTTKKTKRMGWSEHTRAPSGANESKAKERRGGKKVGITNHGTERAERETQETEKETETEQRGGRIGKTVPPHQQPRRSRGYIATPFRKKVERAQMQSTKSTKSTKLTDRPTNQRDPRAKNKIKWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.39
4 0.39
5 0.33
6 0.28
7 0.27
8 0.29
9 0.34
10 0.32
11 0.37
12 0.44
13 0.54
14 0.6
15 0.65
16 0.68
17 0.7
18 0.76
19 0.79
20 0.78
21 0.72
22 0.67
23 0.62
24 0.58
25 0.48
26 0.42
27 0.32
28 0.24
29 0.19
30 0.19
31 0.21
32 0.24
33 0.26
34 0.26
35 0.29
36 0.31
37 0.37
38 0.43
39 0.47
40 0.48
41 0.54
42 0.56
43 0.58
44 0.61
45 0.59
46 0.57
47 0.5
48 0.46
49 0.38
50 0.36
51 0.3
52 0.24
53 0.2
54 0.13
55 0.1
56 0.07
57 0.05
58 0.08
59 0.09
60 0.11
61 0.11
62 0.12
63 0.12
64 0.16
65 0.18
66 0.21
67 0.25
68 0.3
69 0.36
70 0.42
71 0.45
72 0.44
73 0.47
74 0.47
75 0.44
76 0.42
77 0.4
78 0.41
79 0.38
80 0.37
81 0.35
82 0.36
83 0.36
84 0.33
85 0.3
86 0.28
87 0.3
88 0.3
89 0.27
90 0.18
91 0.19
92 0.21
93 0.22
94 0.18
95 0.22
96 0.31
97 0.31
98 0.34
99 0.36
100 0.43
101 0.47
102 0.56
103 0.6
104 0.61
105 0.7
106 0.73
107 0.78
108 0.76
109 0.76
110 0.72
111 0.68
112 0.67
113 0.63
114 0.61
115 0.55
116 0.48
117 0.4
118 0.35
119 0.29
120 0.26
121 0.23
122 0.22
123 0.22
124 0.24
125 0.32
126 0.36
127 0.36
128 0.36
129 0.41
130 0.47
131 0.51
132 0.54
133 0.49
134 0.52
135 0.55
136 0.53
137 0.5
138 0.44
139 0.41
140 0.39
141 0.4
142 0.32
143 0.28
144 0.27
145 0.26
146 0.25
147 0.23
148 0.23
149 0.22
150 0.24
151 0.27
152 0.26
153 0.23
154 0.22
155 0.23
156 0.21
157 0.23
158 0.25
159 0.26
160 0.24
161 0.24
162 0.26
163 0.26
164 0.26
165 0.23
166 0.22
167 0.22
168 0.27
169 0.31
170 0.37
171 0.44
172 0.54
173 0.58
174 0.66
175 0.69
176 0.71
177 0.74
178 0.69
179 0.64
180 0.59
181 0.61
182 0.6
183 0.63
184 0.65
185 0.62
186 0.63
187 0.65
188 0.64
189 0.57
190 0.57
191 0.59
192 0.58
193 0.58
194 0.65
195 0.68
196 0.67
197 0.72
198 0.65
199 0.58
200 0.53
201 0.52
202 0.47
203 0.45
204 0.5
205 0.52
206 0.59
207 0.64
208 0.7
209 0.73
210 0.79
211 0.8
212 0.83
213 0.8
214 0.81
215 0.81
216 0.8
217 0.82
218 0.82
219 0.84