Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L5Q4

Protein Details
Accession E2L5Q4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
110-135QPYRWGTPPPKGKKRDFKKKVPLFGGBasic
NLS Segment(s)
PositionSequence
121-133PPKGKKRDFKKKV
Subcellular Location(s) mito 20, cyto 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032788  AGL_central  
KEGG mpr:MPER_01110  -  
Pfam View protein in Pfam  
PF14702  hGDE_central  
Amino Acid Sequences PGTQKGYLLVAHTAFNKGIKDRGFISPIKLRRTRVKFXFFXXASLRIESYEASQDDTTLKGLPAKLVEIPPKIFPPGSIMLFETRLEHHEALSKESLCLWDNPKAFGAPNLIQPYRWGTPPPKGKKRDFKKKVPLFGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.19
5 0.23
6 0.22
7 0.24
8 0.25
9 0.29
10 0.3
11 0.29
12 0.33
13 0.36
14 0.4
15 0.46
16 0.47
17 0.47
18 0.54
19 0.61
20 0.63
21 0.61
22 0.62
23 0.55
24 0.54
25 0.56
26 0.48
27 0.45
28 0.37
29 0.33
30 0.27
31 0.26
32 0.23
33 0.18
34 0.19
35 0.14
36 0.16
37 0.14
38 0.13
39 0.13
40 0.13
41 0.13
42 0.09
43 0.09
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.1
50 0.12
51 0.15
52 0.15
53 0.16
54 0.16
55 0.17
56 0.17
57 0.15
58 0.13
59 0.14
60 0.15
61 0.14
62 0.14
63 0.14
64 0.14
65 0.15
66 0.15
67 0.12
68 0.1
69 0.11
70 0.14
71 0.13
72 0.12
73 0.17
74 0.17
75 0.2
76 0.22
77 0.21
78 0.17
79 0.18
80 0.19
81 0.15
82 0.18
83 0.18
84 0.22
85 0.22
86 0.24
87 0.24
88 0.23
89 0.22
90 0.21
91 0.24
92 0.18
93 0.24
94 0.29
95 0.28
96 0.28
97 0.29
98 0.33
99 0.29
100 0.3
101 0.28
102 0.26
103 0.36
104 0.46
105 0.56
106 0.59
107 0.65
108 0.74
109 0.8
110 0.87
111 0.89
112 0.87
113 0.88
114 0.89
115 0.9