Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XIZ1

Protein Details
Accession A0A317XIZ1   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-34SFGKRHTKTHTVCRRCNRRAFHRQDKVCHydrophilic
NLS Segment(s)
PositionSequence
52-75KAKRRKTTGTGRMRYLKNVARRAK
Subcellular Location(s) mito 11, nucl 8, cyto 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MTKGTTSFGKRHTKTHTVCRRCNRRAFHRQDKVCASCGYPAAKIRSYEWGQKAKRRKTTGTGRMRYLKNVARRAKNGFQTGAAKKVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.7
4 0.69
5 0.76
6 0.8
7 0.82
8 0.8
9 0.83
10 0.81
11 0.8
12 0.82
13 0.83
14 0.83
15 0.83
16 0.78
17 0.76
18 0.74
19 0.66
20 0.58
21 0.48
22 0.38
23 0.3
24 0.29
25 0.24
26 0.19
27 0.2
28 0.21
29 0.22
30 0.22
31 0.21
32 0.25
33 0.26
34 0.3
35 0.32
36 0.38
37 0.39
38 0.46
39 0.55
40 0.56
41 0.63
42 0.62
43 0.61
44 0.61
45 0.69
46 0.72
47 0.73
48 0.69
49 0.66
50 0.69
51 0.66
52 0.6
53 0.57
54 0.53
55 0.51
56 0.56
57 0.59
58 0.58
59 0.62
60 0.67
61 0.68
62 0.69
63 0.65
64 0.57
65 0.53
66 0.54
67 0.52
68 0.49