Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XWD4

Protein Details
Accession A0A317XWD4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
31-59SKGRPPTQCETCRRKRKQSGRHVRCDCFGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences KYACAACIRGHRTSSCTHKDGSKGPVYPIRSKGRPPTQCETCRRKRKQSGRHVRCDCFGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.41
4 0.39
5 0.39
6 0.41
7 0.42
8 0.42
9 0.38
10 0.33
11 0.34
12 0.37
13 0.38
14 0.38
15 0.41
16 0.41
17 0.37
18 0.39
19 0.46
20 0.5
21 0.53
22 0.55
23 0.56
24 0.59
25 0.65
26 0.71
27 0.71
28 0.72
29 0.77
30 0.79
31 0.81
32 0.83
33 0.86
34 0.88
35 0.9
36 0.91
37 0.9
38 0.92
39 0.9
40 0.83