Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XI44

Protein Details
Accession A0A317XI44    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
20-47KEKSSEKERKKCGARQRQRPLRVQARNPBasic
NLS Segment(s)
PositionSequence
19-36EKEKSSEKERKKCGARQR
Subcellular Location(s) mito 14.5, mito_nucl 11.833, nucl 8, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MRTAVTSKRTITRTGTRGEKEKSSEKERKKCGARQRQRPLRVQARNPTAFTVVILCTVLWYCWKRCWTRYRPSATTRSRPCRTRPSLTAHSLSLPLSPDVRRTSTCLHMREVFRRSRDGEVAEVCTLWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.52
4 0.57
5 0.58
6 0.56
7 0.52
8 0.57
9 0.57
10 0.58
11 0.63
12 0.65
13 0.71
14 0.73
15 0.77
16 0.76
17 0.77
18 0.78
19 0.8
20 0.8
21 0.81
22 0.85
23 0.86
24 0.85
25 0.85
26 0.84
27 0.82
28 0.8
29 0.77
30 0.74
31 0.73
32 0.68
33 0.61
34 0.53
35 0.44
36 0.36
37 0.28
38 0.21
39 0.12
40 0.1
41 0.09
42 0.07
43 0.06
44 0.06
45 0.06
46 0.09
47 0.11
48 0.12
49 0.16
50 0.21
51 0.23
52 0.29
53 0.39
54 0.43
55 0.5
56 0.57
57 0.61
58 0.62
59 0.65
60 0.69
61 0.65
62 0.67
63 0.66
64 0.68
65 0.66
66 0.65
67 0.66
68 0.67
69 0.67
70 0.65
71 0.61
72 0.6
73 0.61
74 0.61
75 0.57
76 0.47
77 0.41
78 0.35
79 0.3
80 0.23
81 0.17
82 0.14
83 0.14
84 0.14
85 0.17
86 0.19
87 0.22
88 0.22
89 0.25
90 0.29
91 0.35
92 0.42
93 0.4
94 0.42
95 0.45
96 0.49
97 0.53
98 0.55
99 0.53
100 0.49
101 0.52
102 0.5
103 0.49
104 0.48
105 0.43
106 0.41
107 0.37
108 0.38
109 0.33