Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M501

Protein Details
Accession E2M501    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-97EYRRLRNTFSARRSRKRKETYVHQLEEHydrophilic
NLS Segment(s)
PositionSequence
82-87RRSRKR
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
KEGG mpr:MPER_15481  -  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MVLEQEKWKTRAKGLRKIAEGQGFPVTFGEWSDEEGESVSRISFASVVPPDEEDKDIGELPPNASGEERAEYRRLRNTFSARRSRKRKETYVHQLEEAAHRLTVPKERWKTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.72
3 0.68
4 0.69
5 0.67
6 0.64
7 0.55
8 0.47
9 0.43
10 0.34
11 0.31
12 0.26
13 0.2
14 0.14
15 0.14
16 0.14
17 0.08
18 0.1
19 0.11
20 0.11
21 0.11
22 0.11
23 0.11
24 0.08
25 0.08
26 0.07
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.09
33 0.09
34 0.1
35 0.1
36 0.11
37 0.12
38 0.12
39 0.13
40 0.09
41 0.09
42 0.09
43 0.09
44 0.08
45 0.09
46 0.08
47 0.08
48 0.1
49 0.1
50 0.09
51 0.09
52 0.1
53 0.09
54 0.11
55 0.12
56 0.12
57 0.15
58 0.17
59 0.2
60 0.28
61 0.28
62 0.3
63 0.36
64 0.43
65 0.48
66 0.56
67 0.63
68 0.64
69 0.73
70 0.79
71 0.82
72 0.83
73 0.83
74 0.84
75 0.82
76 0.84
77 0.85
78 0.84
79 0.77
80 0.67
81 0.6
82 0.53
83 0.48
84 0.41
85 0.31
86 0.21
87 0.18
88 0.2
89 0.21
90 0.27
91 0.29
92 0.36