Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317Y0J2

Protein Details
Accession A0A317Y0J2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-35DQSYTGRHNYDRRRPQQRRKTMTRLDRNAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MTLGPADQSYTGRHNYDRRRPQQRRKTMTRLDRNAEDSESNTSNHGHRSAWWSTLQWSNSRQLVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.52
4 0.6
5 0.65
6 0.73
7 0.81
8 0.87
9 0.89
10 0.9
11 0.89
12 0.87
13 0.87
14 0.84
15 0.84
16 0.83
17 0.78
18 0.71
19 0.64
20 0.59
21 0.51
22 0.43
23 0.33
24 0.24
25 0.23
26 0.2
27 0.18
28 0.15
29 0.15
30 0.15
31 0.17
32 0.17
33 0.14
34 0.15
35 0.2
36 0.21
37 0.23
38 0.23
39 0.22
40 0.24
41 0.31
42 0.31
43 0.3
44 0.31
45 0.35