Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XX01

Protein Details
Accession A0A317XX01    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-25RQGGKAKPLKAPKKQNKELDEDBasic
NLS Segment(s)
PositionSequence
8-17KAKPLKAPKK
Subcellular Location(s) mito 11, nucl 5, extr 5, plas 2, cyto 1, pero 1, E.R. 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MSGRQGGKAKPLKAPKKQNKELDEDVSVARLYGAKPGLAEIGSRRILGLGLHVPLLVAILFLFQSFPLLSSSSIAIAIASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.8
4 0.86
5 0.87
6 0.81
7 0.79
8 0.73
9 0.66
10 0.57
11 0.47
12 0.38
13 0.3
14 0.25
15 0.17
16 0.12
17 0.09
18 0.07
19 0.09
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.09
27 0.07
28 0.11
29 0.11
30 0.11
31 0.11
32 0.1
33 0.1
34 0.1
35 0.11
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.07
42 0.08
43 0.05
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.08
55 0.09
56 0.09
57 0.11
58 0.11
59 0.11
60 0.11
61 0.1