Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XFJ0

Protein Details
Accession A0A317XFJ0    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-55LFPTCSKRSASRCRRRRREWTGGPRNIRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito_nucl 10.833, mito 8.5, cyto_nucl 8.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHQMLQRKQTAPNQTGRAEQGSLFSELFPTCSKRSASRCRRRRREWTGGPRNIRVILPERNITIILYLVAVSWPFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.47
4 0.42
5 0.33
6 0.29
7 0.23
8 0.2
9 0.2
10 0.17
11 0.14
12 0.13
13 0.12
14 0.14
15 0.12
16 0.14
17 0.13
18 0.16
19 0.18
20 0.22
21 0.31
22 0.4
23 0.5
24 0.57
25 0.66
26 0.74
27 0.83
28 0.85
29 0.88
30 0.86
31 0.86
32 0.86
33 0.87
34 0.87
35 0.85
36 0.81
37 0.72
38 0.65
39 0.56
40 0.46
41 0.38
42 0.32
43 0.31
44 0.3
45 0.3
46 0.29
47 0.28
48 0.28
49 0.25
50 0.2
51 0.14
52 0.1
53 0.08
54 0.07
55 0.06
56 0.07