Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XN86

Protein Details
Accession A0A317XN86   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-113IGASHPPHTGRRRDRRRRRGSPFBasic
NLS Segment(s)
PositionSequence
99-112TGRRRDRRRRRGSP
Subcellular Location(s) extr 15, plas 6, vacu 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRHHGSIGLVRLCRVLHVVGSLFCAVTVVVAGDATAAIVVLVAGVRCQVASVGSTSGVVCRGWTAASGVGIICSDAVVRLLVLVANEILVIGASHPPHTGRRRDRRRRRGSPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.16
3 0.11
4 0.13
5 0.14
6 0.12
7 0.15
8 0.14
9 0.12
10 0.11
11 0.1
12 0.08
13 0.06
14 0.06
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.05
59 0.04
60 0.03
61 0.03
62 0.03
63 0.04
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.03
77 0.03
78 0.03
79 0.06
80 0.07
81 0.08
82 0.09
83 0.12
84 0.2
85 0.27
86 0.37
87 0.45
88 0.56
89 0.67
90 0.78
91 0.87
92 0.9
93 0.94