Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XP32

Protein Details
Accession A0A317XP32    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-66GFWWCGLGRHRQRRRWRRLLCWKSESMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 8.5, extr 7, plas 3
Family & Domain DBs
Amino Acid Sequences MLLNSSLHPLRTCILLFLVSCSRRSAISSHLSSSCFQTLGFWWCGLGRHRQRRRWRRLLCWKSESMFFEAKHGRVGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.16
5 0.22
6 0.2
7 0.21
8 0.21
9 0.21
10 0.2
11 0.21
12 0.19
13 0.17
14 0.23
15 0.24
16 0.25
17 0.26
18 0.27
19 0.26
20 0.27
21 0.22
22 0.15
23 0.13
24 0.11
25 0.11
26 0.14
27 0.14
28 0.11
29 0.11
30 0.11
31 0.13
32 0.15
33 0.23
34 0.29
35 0.39
36 0.48
37 0.57
38 0.68
39 0.77
40 0.86
41 0.87
42 0.85
43 0.85
44 0.88
45 0.89
46 0.86
47 0.82
48 0.75
49 0.67
50 0.64
51 0.56
52 0.5
53 0.46
54 0.37
55 0.39
56 0.39
57 0.38