Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XM37

Protein Details
Accession A0A317XM37    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-32PELDRQRKDNHKEVERRRRSABasic
NLS Segment(s)
PositionSequence
7-30KRPRGPELDRQRKDNHKEVERRRR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR047206  bHLHzip_scCBP1-like  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
CDD cd11398  bHLHzip_scCBP1  
Amino Acid Sequences PTSRGVKRPRGPELDRQRKDNHKEVERRRRSAISDGIANLSHIVPGCDAKNTNKGAIIHAAVRYIQDLKHNEASNIEKWTLEKLLMDQALGDLNAQLEDLRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.74
3 0.7
4 0.7
5 0.71
6 0.73
7 0.72
8 0.69
9 0.67
10 0.74
11 0.79
12 0.82
13 0.81
14 0.78
15 0.74
16 0.68
17 0.62
18 0.58
19 0.53
20 0.44
21 0.38
22 0.34
23 0.3
24 0.27
25 0.23
26 0.18
27 0.12
28 0.1
29 0.07
30 0.07
31 0.06
32 0.07
33 0.07
34 0.08
35 0.09
36 0.11
37 0.17
38 0.18
39 0.18
40 0.19
41 0.19
42 0.19
43 0.2
44 0.19
45 0.14
46 0.13
47 0.13
48 0.11
49 0.1
50 0.1
51 0.09
52 0.09
53 0.14
54 0.16
55 0.21
56 0.27
57 0.28
58 0.27
59 0.29
60 0.32
61 0.29
62 0.3
63 0.25
64 0.19
65 0.19
66 0.22
67 0.2
68 0.17
69 0.14
70 0.12
71 0.18
72 0.18
73 0.17
74 0.14
75 0.13
76 0.14
77 0.13
78 0.12
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07