Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XLW4

Protein Details
Accession A0A317XLW4    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-65EPKSRRWPDCGEKQKKKRERPELNFPQSRSBasic
NLS Segment(s)
PositionSequence
50-53KKKR
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MSLTSLLVDAFCQLSEVCQARFFRKCPLAYITAWDEPKSRRWPDCGEKQKKKRERPELNFPQSRSCLTFFSIVVRKQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.13
3 0.15
4 0.15
5 0.19
6 0.21
7 0.26
8 0.3
9 0.31
10 0.34
11 0.38
12 0.38
13 0.37
14 0.39
15 0.37
16 0.32
17 0.35
18 0.31
19 0.29
20 0.28
21 0.26
22 0.24
23 0.22
24 0.28
25 0.31
26 0.31
27 0.28
28 0.32
29 0.38
30 0.43
31 0.52
32 0.57
33 0.61
34 0.68
35 0.75
36 0.82
37 0.85
38 0.88
39 0.88
40 0.88
41 0.88
42 0.86
43 0.88
44 0.88
45 0.88
46 0.84
47 0.75
48 0.7
49 0.61
50 0.56
51 0.48
52 0.4
53 0.32
54 0.28
55 0.3
56 0.23
57 0.28
58 0.32