Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XYZ3

Protein Details
Accession A0A317XYZ3   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MKRERERERERKGEKREKGRKEKKREKKDDREEVEKEBasic
NLS Segment(s)
PositionSequence
2-43KRERERERERKGEKREKGRKEKKREKKDDREEVEKEKRGKNR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MKRERERERERKGEKREKGRKEKKREKKDDREEVEKEKRGKNRDGDNEKERVNLKSSNTITKDDQSKFRGDTSSTITIIMSAKFGITIAGLQASRAGITSRDMIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.87
5 0.9
6 0.91
7 0.9
8 0.91
9 0.93
10 0.93
11 0.94
12 0.94
13 0.94
14 0.94
15 0.94
16 0.93
17 0.89
18 0.85
19 0.78
20 0.75
21 0.73
22 0.68
23 0.62
24 0.57
25 0.57
26 0.55
27 0.57
28 0.55
29 0.56
30 0.6
31 0.61
32 0.62
33 0.6
34 0.58
35 0.52
36 0.48
37 0.4
38 0.32
39 0.28
40 0.24
41 0.21
42 0.26
43 0.27
44 0.3
45 0.31
46 0.33
47 0.31
48 0.32
49 0.38
50 0.32
51 0.36
52 0.33
53 0.33
54 0.31
55 0.32
56 0.29
57 0.24
58 0.24
59 0.25
60 0.26
61 0.23
62 0.22
63 0.2
64 0.19
65 0.19
66 0.17
67 0.11
68 0.07
69 0.07
70 0.07
71 0.07
72 0.06
73 0.05
74 0.05
75 0.05
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.1
83 0.1
84 0.08
85 0.11