Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XMC6

Protein Details
Accession A0A317XMC6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
48-70QHQLLHRYRHRHRHRFQIRYSFTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MKVRSSVKKFCDGCSVVRRKGRLYVICSKDPKHKQVRVAIALLYTHIQHQLLHRYRHRHRHRFQIRYSFTPFACEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.52
4 0.55
5 0.55
6 0.48
7 0.52
8 0.53
9 0.49
10 0.48
11 0.51
12 0.51
13 0.56
14 0.57
15 0.53
16 0.55
17 0.55
18 0.57
19 0.56
20 0.55
21 0.54
22 0.58
23 0.61
24 0.54
25 0.49
26 0.4
27 0.31
28 0.26
29 0.21
30 0.15
31 0.09
32 0.07
33 0.07
34 0.07
35 0.08
36 0.11
37 0.21
38 0.26
39 0.33
40 0.38
41 0.47
42 0.55
43 0.65
44 0.73
45 0.74
46 0.74
47 0.78
48 0.83
49 0.83
50 0.84
51 0.84
52 0.79
53 0.74
54 0.75
55 0.69
56 0.58