Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1CK73

Protein Details
Accession A1CK73    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKRKSKKAKEKKEAQKGPKEMSBasic
NLS Segment(s)
PositionSequence
2-19KRKSKKAKEKKEAQKGPK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
KEGG act:ACLA_037540  -  
Amino Acid Sequences MKRKSKKAKEKKEAQKGPKEMSEEDISKEMERLRQALQKEEEEVVRKRAKIEELEGLSWRLARETNNVKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.84
4 0.78
5 0.71
6 0.64
7 0.53
8 0.48
9 0.43
10 0.34
11 0.3
12 0.28
13 0.24
14 0.2
15 0.21
16 0.17
17 0.16
18 0.15
19 0.15
20 0.16
21 0.19
22 0.2
23 0.23
24 0.25
25 0.23
26 0.23
27 0.23
28 0.22
29 0.23
30 0.24
31 0.25
32 0.26
33 0.25
34 0.25
35 0.28
36 0.29
37 0.28
38 0.3
39 0.31
40 0.31
41 0.32
42 0.31
43 0.29
44 0.26
45 0.24
46 0.21
47 0.14
48 0.13
49 0.14
50 0.21
51 0.31