Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XY39

Protein Details
Accession A0A317XY39    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-35LHTRVRCSRCHFRRGCKKCCAIRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, extr 10
Family & Domain DBs
Amino Acid Sequences MLLNCYTIAVLALHTRVRCSRCHFRRGCKKCCAIRSGSQNILWLLLIMCSTQEKKRGRVRGGLGVVTGQASGGQIRSLISEPLTTALYCTVACSPCFGWRHAQHRLVPGGHRKWVTTLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.23
4 0.25
5 0.29
6 0.36
7 0.45
8 0.49
9 0.59
10 0.63
11 0.69
12 0.78
13 0.82
14 0.82
15 0.8
16 0.81
17 0.78
18 0.77
19 0.72
20 0.66
21 0.64
22 0.64
23 0.61
24 0.56
25 0.49
26 0.44
27 0.39
28 0.34
29 0.26
30 0.17
31 0.11
32 0.08
33 0.07
34 0.05
35 0.05
36 0.06
37 0.08
38 0.1
39 0.18
40 0.2
41 0.28
42 0.35
43 0.42
44 0.43
45 0.47
46 0.48
47 0.47
48 0.46
49 0.39
50 0.31
51 0.24
52 0.22
53 0.15
54 0.12
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.09
70 0.1
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.09
77 0.11
78 0.12
79 0.12
80 0.15
81 0.15
82 0.21
83 0.23
84 0.24
85 0.3
86 0.36
87 0.43
88 0.49
89 0.54
90 0.52
91 0.56
92 0.6
93 0.54
94 0.53
95 0.56
96 0.53
97 0.53
98 0.5
99 0.45