Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XM26

Protein Details
Accession A0A317XM26    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-23GRRCLARKRGSWRREGRGRRAVBasic
NLS Segment(s)
PositionSequence
8-21RKRGSWRREGRGRR
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGRRCLARKRGSWRREGRGRRAVYRIVCLPLLYYCSCTVLTTVDLWVSCCNVQPLLSLTSQSSPVQSSAVQYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.8
5 0.79
6 0.78
7 0.73
8 0.68
9 0.64
10 0.55
11 0.51
12 0.44
13 0.36
14 0.31
15 0.26
16 0.22
17 0.17
18 0.18
19 0.13
20 0.12
21 0.1
22 0.12
23 0.12
24 0.11
25 0.11
26 0.09
27 0.09
28 0.08
29 0.08
30 0.07
31 0.07
32 0.08
33 0.08
34 0.09
35 0.08
36 0.09
37 0.1
38 0.09
39 0.1
40 0.1
41 0.13
42 0.14
43 0.14
44 0.14
45 0.14
46 0.16
47 0.18
48 0.17
49 0.16
50 0.15
51 0.15
52 0.16
53 0.15