Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XFP4

Protein Details
Accession A0A317XFP4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-32LYIQRKGRGRYHRQREPIPVWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MKSGIWQHGPVLYIQRKGRGRYHRQREPIPVWVCTDNSCERLVCHRACLARKRPFCGTVLTRDAPRITVVSTVVLFDLSGLSAAASVERARASFSPSRHDSRSGRTTPPPLTRCLLLPDSFSAHCNRCCLSLCY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.44
4 0.49
5 0.56
6 0.57
7 0.64
8 0.68
9 0.76
10 0.77
11 0.79
12 0.81
13 0.81
14 0.74
15 0.73
16 0.65
17 0.56
18 0.5
19 0.44
20 0.38
21 0.31
22 0.31
23 0.24
24 0.23
25 0.22
26 0.19
27 0.18
28 0.24
29 0.28
30 0.24
31 0.23
32 0.25
33 0.29
34 0.34
35 0.42
36 0.46
37 0.49
38 0.52
39 0.54
40 0.54
41 0.51
42 0.47
43 0.44
44 0.37
45 0.33
46 0.35
47 0.32
48 0.29
49 0.28
50 0.27
51 0.21
52 0.19
53 0.14
54 0.09
55 0.09
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.06
62 0.05
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.04
74 0.05
75 0.05
76 0.06
77 0.08
78 0.08
79 0.14
80 0.18
81 0.19
82 0.26
83 0.31
84 0.36
85 0.36
86 0.42
87 0.4
88 0.44
89 0.51
90 0.47
91 0.48
92 0.48
93 0.52
94 0.53
95 0.59
96 0.53
97 0.48
98 0.47
99 0.43
100 0.4
101 0.39
102 0.36
103 0.28
104 0.28
105 0.26
106 0.28
107 0.27
108 0.27
109 0.27
110 0.28
111 0.3
112 0.31
113 0.29
114 0.29