Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XSP2

Protein Details
Accession A0A317XSP2   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
17-38WKNPWRLSPTRKNRVRMRLRAVHydrophilic
80-105HPGFRKSVHKVPKWTRKTIRENPVGYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTMASMGGLLWKNPWRLSPTRKNRVRMRLRAVDDVIATLQQSQVQCASLTRALQIPKESQMLPKDKYTTFSKHHPGFRKSVHKVPKWTRKTIRENPVGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.16
4 0.2
5 0.22
6 0.23
7 0.25
8 0.26
9 0.34
10 0.43
11 0.5
12 0.57
13 0.65
14 0.71
15 0.77
16 0.79
17 0.83
18 0.83
19 0.81
20 0.78
21 0.76
22 0.73
23 0.68
24 0.6
25 0.51
26 0.4
27 0.32
28 0.24
29 0.15
30 0.11
31 0.07
32 0.06
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.08
39 0.08
40 0.1
41 0.09
42 0.09
43 0.09
44 0.12
45 0.12
46 0.14
47 0.15
48 0.15
49 0.16
50 0.18
51 0.18
52 0.19
53 0.24
54 0.28
55 0.29
56 0.3
57 0.32
58 0.3
59 0.34
60 0.35
61 0.35
62 0.34
63 0.4
64 0.46
65 0.49
66 0.56
67 0.61
68 0.6
69 0.61
70 0.65
71 0.68
72 0.65
73 0.67
74 0.69
75 0.67
76 0.73
77 0.77
78 0.79
79 0.76
80 0.8
81 0.81
82 0.82
83 0.85
84 0.85
85 0.85