Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317XJH0

Protein Details
Accession A0A317XJH0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-100RTSACVLEKKKKKPPDASLPDHydrophilic
NLS Segment(s)
PositionSequence
89-92KKKK
Subcellular Location(s) mito 8, plas 6, golg 4, mito_nucl 4, extr 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTRTDVRRAKYTHHTTPFRVPAVTTFFFFLIHIPFLDPLLFPSLCLDAFPFAITRMTASLALSIGRFCVPRPQITSVNHRTSACVLEKKKKKPPDASLPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.63
3 0.69
4 0.68
5 0.6
6 0.52
7 0.42
8 0.36
9 0.38
10 0.35
11 0.26
12 0.22
13 0.2
14 0.2
15 0.19
16 0.16
17 0.11
18 0.1
19 0.1
20 0.09
21 0.09
22 0.09
23 0.09
24 0.08
25 0.07
26 0.1
27 0.1
28 0.09
29 0.1
30 0.1
31 0.1
32 0.1
33 0.09
34 0.06
35 0.06
36 0.07
37 0.06
38 0.05
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.15
56 0.17
57 0.21
58 0.26
59 0.31
60 0.36
61 0.4
62 0.5
63 0.49
64 0.53
65 0.52
66 0.48
67 0.45
68 0.4
69 0.41
70 0.38
71 0.38
72 0.38
73 0.46
74 0.55
75 0.62
76 0.7
77 0.74
78 0.78
79 0.79
80 0.83