Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XU83

Protein Details
Accession A0A317XU83    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
140-168AKRRIPAPNAPRKTRPNRNPKAAPKFDQQHydrophilic
NLS Segment(s)
PositionSequence
141-161KRRIPAPNAPRKTRPNRNPKA
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MPPKAGKKGNKDGKGSGGSATWTLPKTIINPEHHHTLNHLDQVSSFYAAIASVHSPTEASHGKQSSSRVAASSRAMQAHLRRDMQSLSKKALIRMDRSLKRPTCPRCSSLAVPGLTARTRNKASGPHDHIVANTCLVCNAKRRIPAPNAPRKTRPNRNPKAAPKFDQQDPTNFVVVRGVGKNGMVGPVLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.54
3 0.44
4 0.35
5 0.29
6 0.24
7 0.22
8 0.19
9 0.16
10 0.16
11 0.15
12 0.16
13 0.17
14 0.25
15 0.31
16 0.33
17 0.38
18 0.41
19 0.47
20 0.46
21 0.44
22 0.37
23 0.37
24 0.34
25 0.33
26 0.3
27 0.23
28 0.23
29 0.26
30 0.24
31 0.19
32 0.15
33 0.1
34 0.1
35 0.1
36 0.09
37 0.07
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.12
45 0.13
46 0.14
47 0.19
48 0.2
49 0.21
50 0.23
51 0.26
52 0.25
53 0.25
54 0.24
55 0.19
56 0.19
57 0.21
58 0.2
59 0.22
60 0.19
61 0.17
62 0.18
63 0.2
64 0.23
65 0.27
66 0.29
67 0.27
68 0.26
69 0.27
70 0.27
71 0.31
72 0.33
73 0.29
74 0.27
75 0.3
76 0.3
77 0.3
78 0.35
79 0.31
80 0.27
81 0.32
82 0.38
83 0.38
84 0.41
85 0.48
86 0.43
87 0.45
88 0.5
89 0.5
90 0.51
91 0.5
92 0.49
93 0.46
94 0.49
95 0.46
96 0.43
97 0.42
98 0.33
99 0.29
100 0.27
101 0.24
102 0.2
103 0.22
104 0.18
105 0.18
106 0.19
107 0.2
108 0.22
109 0.27
110 0.32
111 0.39
112 0.44
113 0.4
114 0.4
115 0.39
116 0.37
117 0.33
118 0.29
119 0.2
120 0.13
121 0.11
122 0.11
123 0.12
124 0.13
125 0.17
126 0.21
127 0.25
128 0.3
129 0.32
130 0.38
131 0.44
132 0.52
133 0.56
134 0.62
135 0.65
136 0.66
137 0.73
138 0.75
139 0.78
140 0.8
141 0.8
142 0.8
143 0.82
144 0.86
145 0.88
146 0.89
147 0.89
148 0.86
149 0.81
150 0.79
151 0.75
152 0.71
153 0.7
154 0.61
155 0.57
156 0.55
157 0.53
158 0.47
159 0.41
160 0.35
161 0.29
162 0.27
163 0.25
164 0.21
165 0.19
166 0.16
167 0.17
168 0.18
169 0.16
170 0.17