Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XYE9

Protein Details
Accession A0A317XYE9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-60TVHPCNSIIHRRKKRGRKRTGWLATSHydrophilic
NLS Segment(s)
PositionSequence
45-53RRKKRGRKR
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNHVQSGIVVRSASHMRECGARACSRGSEWRDRDTVHPCNSIIHRRKKRGRKRTGWLATSFVTGFLIVCPPSQLPCLAVQGLSTRPTLMTPSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.21
5 0.23
6 0.23
7 0.25
8 0.25
9 0.24
10 0.26
11 0.26
12 0.25
13 0.31
14 0.32
15 0.37
16 0.39
17 0.41
18 0.41
19 0.41
20 0.43
21 0.42
22 0.44
23 0.37
24 0.36
25 0.32
26 0.33
27 0.35
28 0.41
29 0.42
30 0.46
31 0.51
32 0.59
33 0.68
34 0.75
35 0.83
36 0.84
37 0.86
38 0.84
39 0.85
40 0.86
41 0.85
42 0.78
43 0.69
44 0.61
45 0.51
46 0.43
47 0.34
48 0.23
49 0.16
50 0.11
51 0.1
52 0.07
53 0.08
54 0.07
55 0.07
56 0.08
57 0.08
58 0.1
59 0.11
60 0.11
61 0.11
62 0.13
63 0.15
64 0.15
65 0.14
66 0.13
67 0.15
68 0.17
69 0.18
70 0.16
71 0.14
72 0.14
73 0.15
74 0.17