Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317XRT4

Protein Details
Accession A0A317XRT4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKSSSKKPGGGKKPPPLDTBasic
NLS Segment(s)
PositionSequence
3-17KRKSSSKKPGGGKKP
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKKPGGGKKPPPLDTVFTCLFCNHERAVSCRIDDKARIGYLSCKVCGQKFSADTNPLDQPIDVYSLWIDACEDVANEQDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.77
5 0.71
6 0.64
7 0.58
8 0.5
9 0.46
10 0.39
11 0.31
12 0.29
13 0.26
14 0.25
15 0.21
16 0.22
17 0.16
18 0.17
19 0.17
20 0.19
21 0.24
22 0.22
23 0.21
24 0.22
25 0.23
26 0.21
27 0.21
28 0.2
29 0.19
30 0.18
31 0.18
32 0.15
33 0.16
34 0.2
35 0.21
36 0.19
37 0.18
38 0.19
39 0.2
40 0.21
41 0.21
42 0.2
43 0.22
44 0.26
45 0.28
46 0.3
47 0.3
48 0.32
49 0.31
50 0.27
51 0.24
52 0.19
53 0.16
54 0.13
55 0.15
56 0.12
57 0.11
58 0.1
59 0.1
60 0.1
61 0.09
62 0.09
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07