Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CJM1

Protein Details
Accession A1CJM1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
165-187GVELKKEKEKEKEKERAREKDVVBasic
NLS Segment(s)
PositionSequence
169-182KKEKEKEKEKERAR
Subcellular Location(s) mito 11, cyto 8, cyto_nucl 7.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038814  AIM11  
Gene Ontology GO:0016020  C:membrane  
KEGG act:ACLA_035480  -  
Amino Acid Sequences MLLSSLFNRAASPSADPSDTQNPPSSSPTSTTTTNPPPNLPRHYTNLKLLFGGVTFFALSVLVTRRAFTKRVLACRPPYYTASVYHQPPANGAGDAFEALSLATLNVCSFAMMATGGVLYALDVASLEDMRRYVKKEMGEGTVRDEAVEKEVEQWVEKVLGEKFGVELKKEKEKEKEKERAREKDVVVSESEGGGNGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.27
5 0.33
6 0.33
7 0.33
8 0.35
9 0.34
10 0.36
11 0.39
12 0.36
13 0.3
14 0.31
15 0.32
16 0.3
17 0.3
18 0.3
19 0.33
20 0.4
21 0.44
22 0.43
23 0.44
24 0.46
25 0.5
26 0.54
27 0.53
28 0.48
29 0.48
30 0.53
31 0.52
32 0.54
33 0.52
34 0.46
35 0.4
36 0.36
37 0.3
38 0.23
39 0.2
40 0.12
41 0.07
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.11
50 0.11
51 0.12
52 0.15
53 0.18
54 0.2
55 0.2
56 0.27
57 0.28
58 0.36
59 0.41
60 0.44
61 0.47
62 0.5
63 0.51
64 0.46
65 0.42
66 0.38
67 0.34
68 0.3
69 0.3
70 0.3
71 0.28
72 0.28
73 0.28
74 0.23
75 0.22
76 0.22
77 0.17
78 0.13
79 0.11
80 0.09
81 0.07
82 0.07
83 0.07
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.02
90 0.02
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.03
113 0.04
114 0.04
115 0.04
116 0.05
117 0.07
118 0.09
119 0.13
120 0.15
121 0.19
122 0.21
123 0.24
124 0.26
125 0.29
126 0.31
127 0.28
128 0.3
129 0.28
130 0.26
131 0.23
132 0.21
133 0.17
134 0.16
135 0.16
136 0.11
137 0.11
138 0.14
139 0.14
140 0.14
141 0.14
142 0.13
143 0.13
144 0.13
145 0.14
146 0.12
147 0.14
148 0.13
149 0.13
150 0.13
151 0.17
152 0.18
153 0.17
154 0.23
155 0.25
156 0.35
157 0.39
158 0.45
159 0.5
160 0.59
161 0.67
162 0.71
163 0.76
164 0.75
165 0.82
166 0.86
167 0.85
168 0.81
169 0.8
170 0.71
171 0.69
172 0.63
173 0.55
174 0.47
175 0.39
176 0.34
177 0.26
178 0.24
179 0.16