Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R496

Protein Details
Accession C4R496    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
112-139RQAPIPKLPRKEKKIKKIRSDNKLELKEBasic
NLS Segment(s)
PositionSequence
117-130PKLPRKEKKIKKIR
Subcellular Location(s) nucl 14, mito 5, cyto 4, vacu 2
Family & Domain DBs
KEGG ppa:PAS_chr3_1178  -  
Amino Acid Sequences MATTLQSLVTLFLFLGSTFAYQLKAIDFAQNSFNLATLEFDSKWKLHTGEQLDLPSDLYRICLDEGCFNYKRLSSPIAQDIKLTINKHNDIENVAFFDASQKGLNLIVEQIRQAPIPKLPRKEKKIKKIRSDNKLELKEVIDEEAEVNVDNRSFIQKYWMYIVPALLIMLISGNQNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.08
6 0.09
7 0.09
8 0.09
9 0.1
10 0.1
11 0.12
12 0.12
13 0.16
14 0.16
15 0.17
16 0.19
17 0.19
18 0.19
19 0.17
20 0.17
21 0.12
22 0.11
23 0.11
24 0.11
25 0.13
26 0.12
27 0.14
28 0.16
29 0.15
30 0.17
31 0.18
32 0.17
33 0.17
34 0.24
35 0.27
36 0.28
37 0.3
38 0.29
39 0.28
40 0.26
41 0.24
42 0.18
43 0.13
44 0.1
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.13
52 0.16
53 0.2
54 0.21
55 0.21
56 0.22
57 0.21
58 0.22
59 0.2
60 0.21
61 0.16
62 0.18
63 0.25
64 0.27
65 0.26
66 0.25
67 0.24
68 0.24
69 0.26
70 0.24
71 0.2
72 0.22
73 0.23
74 0.24
75 0.24
76 0.21
77 0.2
78 0.19
79 0.15
80 0.12
81 0.11
82 0.1
83 0.08
84 0.1
85 0.08
86 0.08
87 0.08
88 0.07
89 0.07
90 0.08
91 0.08
92 0.06
93 0.07
94 0.08
95 0.08
96 0.08
97 0.09
98 0.09
99 0.1
100 0.11
101 0.11
102 0.15
103 0.24
104 0.3
105 0.38
106 0.47
107 0.57
108 0.64
109 0.73
110 0.78
111 0.8
112 0.84
113 0.86
114 0.87
115 0.88
116 0.89
117 0.88
118 0.88
119 0.86
120 0.85
121 0.79
122 0.69
123 0.6
124 0.52
125 0.44
126 0.35
127 0.27
128 0.17
129 0.14
130 0.13
131 0.11
132 0.1
133 0.08
134 0.08
135 0.07
136 0.07
137 0.07
138 0.07
139 0.12
140 0.13
141 0.13
142 0.2
143 0.22
144 0.24
145 0.29
146 0.31
147 0.29
148 0.29
149 0.29
150 0.22
151 0.2
152 0.18
153 0.12
154 0.09
155 0.06
156 0.06
157 0.06