Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316ZGN8

Protein Details
Accession A0A316ZGN8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-38GSSRRCNGVRHCHARCPKRLLHydrophilic
320-341AARVWAPKARRQRQRALLRASEHydrophilic
NLS Segment(s)
PositionSequence
325-364APKARRQRQRALLRASEARPSPRRQGGFARSPVRGMRRAA
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPGRQLPGRDIGPRVSEGSSRRCNGVRHCHARCPKRLLASVTPAHGALNALPPSLEPRCLYVKVSTTCVERTKRRLLARELLLFCPAPKAGLDGCVRRGVRCSRQEDLELPTLCSPSLSRPWSGAPSVDLGPRPSCVAAAAASCFGGAAPRLAPASATRFGGHACSGAAARMGACRVGSLDVGEDTADVLPRRRRAHLLRCSLASHVRGEAAYFKSRSASLPSCCLVGRAEPRVRAPVPLLRHVMRWPQPVSNALRLAQKSAASVQAREADVLVRWQPVRQNVPSSALASELTLFYRRAAARAWLSVSGRRGPTCTAAAAARVWAPKARRQRQRALLRASEARPSPRRQGGFARSPVRGMRRAARCSAARGGARCRRWADFCSSGQRVCAVRVGASGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.32
4 0.33
5 0.39
6 0.44
7 0.42
8 0.45
9 0.47
10 0.51
11 0.55
12 0.61
13 0.62
14 0.64
15 0.68
16 0.73
17 0.78
18 0.82
19 0.81
20 0.78
21 0.74
22 0.72
23 0.72
24 0.69
25 0.66
26 0.66
27 0.6
28 0.54
29 0.48
30 0.4
31 0.34
32 0.27
33 0.21
34 0.14
35 0.18
36 0.16
37 0.15
38 0.15
39 0.15
40 0.2
41 0.21
42 0.23
43 0.16
44 0.2
45 0.25
46 0.27
47 0.29
48 0.27
49 0.33
50 0.33
51 0.36
52 0.35
53 0.33
54 0.36
55 0.41
56 0.45
57 0.44
58 0.49
59 0.55
60 0.6
61 0.64
62 0.67
63 0.66
64 0.68
65 0.67
66 0.68
67 0.61
68 0.54
69 0.5
70 0.42
71 0.35
72 0.29
73 0.22
74 0.14
75 0.11
76 0.13
77 0.11
78 0.18
79 0.22
80 0.22
81 0.24
82 0.3
83 0.31
84 0.28
85 0.34
86 0.35
87 0.4
88 0.46
89 0.49
90 0.46
91 0.49
92 0.51
93 0.47
94 0.45
95 0.43
96 0.36
97 0.31
98 0.29
99 0.26
100 0.23
101 0.21
102 0.17
103 0.14
104 0.21
105 0.21
106 0.21
107 0.22
108 0.25
109 0.27
110 0.27
111 0.23
112 0.17
113 0.17
114 0.18
115 0.19
116 0.17
117 0.17
118 0.16
119 0.16
120 0.16
121 0.13
122 0.12
123 0.1
124 0.1
125 0.08
126 0.08
127 0.08
128 0.08
129 0.07
130 0.07
131 0.06
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.06
140 0.07
141 0.08
142 0.13
143 0.13
144 0.14
145 0.13
146 0.14
147 0.14
148 0.15
149 0.14
150 0.09
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.05
157 0.05
158 0.05
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.05
167 0.06
168 0.05
169 0.06
170 0.05
171 0.05
172 0.04
173 0.04
174 0.06
175 0.05
176 0.09
177 0.12
178 0.18
179 0.21
180 0.22
181 0.29
182 0.35
183 0.45
184 0.51
185 0.54
186 0.5
187 0.49
188 0.48
189 0.44
190 0.39
191 0.3
192 0.22
193 0.15
194 0.14
195 0.12
196 0.12
197 0.14
198 0.14
199 0.16
200 0.15
201 0.15
202 0.16
203 0.16
204 0.17
205 0.19
206 0.2
207 0.18
208 0.21
209 0.22
210 0.22
211 0.21
212 0.21
213 0.15
214 0.16
215 0.18
216 0.22
217 0.25
218 0.25
219 0.27
220 0.31
221 0.31
222 0.28
223 0.26
224 0.24
225 0.25
226 0.28
227 0.31
228 0.26
229 0.27
230 0.29
231 0.34
232 0.34
233 0.36
234 0.33
235 0.31
236 0.32
237 0.36
238 0.38
239 0.35
240 0.31
241 0.28
242 0.31
243 0.29
244 0.3
245 0.26
246 0.23
247 0.19
248 0.18
249 0.23
250 0.19
251 0.19
252 0.19
253 0.21
254 0.21
255 0.2
256 0.19
257 0.13
258 0.13
259 0.15
260 0.14
261 0.13
262 0.13
263 0.14
264 0.18
265 0.23
266 0.29
267 0.29
268 0.33
269 0.31
270 0.36
271 0.36
272 0.33
273 0.27
274 0.22
275 0.19
276 0.15
277 0.14
278 0.09
279 0.09
280 0.1
281 0.1
282 0.1
283 0.16
284 0.16
285 0.16
286 0.17
287 0.21
288 0.21
289 0.23
290 0.25
291 0.23
292 0.24
293 0.27
294 0.29
295 0.3
296 0.3
297 0.29
298 0.28
299 0.27
300 0.29
301 0.27
302 0.24
303 0.2
304 0.18
305 0.19
306 0.17
307 0.16
308 0.15
309 0.15
310 0.15
311 0.18
312 0.21
313 0.27
314 0.38
315 0.47
316 0.54
317 0.61
318 0.7
319 0.76
320 0.83
321 0.84
322 0.81
323 0.76
324 0.72
325 0.71
326 0.63
327 0.59
328 0.52
329 0.51
330 0.5
331 0.51
332 0.54
333 0.55
334 0.55
335 0.53
336 0.6
337 0.6
338 0.62
339 0.65
340 0.62
341 0.55
342 0.56
343 0.57
344 0.54
345 0.51
346 0.47
347 0.48
348 0.51
349 0.56
350 0.56
351 0.58
352 0.53
353 0.54
354 0.54
355 0.52
356 0.48
357 0.47
358 0.53
359 0.55
360 0.56
361 0.58
362 0.56
363 0.55
364 0.55
365 0.55
366 0.54
367 0.52
368 0.53
369 0.55
370 0.55
371 0.5
372 0.46
373 0.47
374 0.4
375 0.35
376 0.34
377 0.26
378 0.23