Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316Z879

Protein Details
Accession A0A316Z879    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPATKIPIVKKRTKKFKRHHSDRYHRVGESBasic
NLS Segment(s)
PositionSequence
9-36VKKRTKKFKRHHSDRYHRVGESHRHERG
42-44RRR
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPATKIPIVKKRTKKFKRHHSDRYHRVGESHRHERGIDSAVRRRFRGTAAQPKIGYGSNKKTRHLMPNGYRRLVVSNVNDVELLLMHNQSFAAEIAHNVSSRKRIEILEKAKVLGVKVTNANAKLRAEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.91
4 0.93
5 0.93
6 0.93
7 0.93
8 0.94
9 0.93
10 0.91
11 0.84
12 0.73
13 0.66
14 0.62
15 0.6
16 0.58
17 0.57
18 0.5
19 0.47
20 0.46
21 0.44
22 0.4
23 0.35
24 0.3
25 0.27
26 0.32
27 0.38
28 0.4
29 0.39
30 0.39
31 0.35
32 0.34
33 0.37
34 0.39
35 0.42
36 0.45
37 0.49
38 0.47
39 0.46
40 0.45
41 0.38
42 0.32
43 0.26
44 0.3
45 0.35
46 0.37
47 0.38
48 0.41
49 0.42
50 0.47
51 0.48
52 0.47
53 0.46
54 0.53
55 0.56
56 0.53
57 0.49
58 0.42
59 0.38
60 0.32
61 0.28
62 0.2
63 0.21
64 0.2
65 0.21
66 0.2
67 0.17
68 0.16
69 0.11
70 0.1
71 0.05
72 0.06
73 0.05
74 0.05
75 0.05
76 0.05
77 0.06
78 0.05
79 0.06
80 0.06
81 0.06
82 0.09
83 0.1
84 0.11
85 0.11
86 0.13
87 0.18
88 0.19
89 0.21
90 0.21
91 0.22
92 0.29
93 0.38
94 0.43
95 0.45
96 0.45
97 0.43
98 0.42
99 0.41
100 0.35
101 0.3
102 0.25
103 0.21
104 0.23
105 0.27
106 0.3
107 0.31
108 0.34
109 0.33
110 0.32