Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316ZID0

Protein Details
Accession A0A316ZID0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
111-130PGKVRPPKSKRTQRAPPTGTHydrophilic
175-202ADAEDAGNRRRKKPKRKRGDMGNTSIDGBasic
NLS Segment(s)
PositionSequence
182-215NRRRKKPKRKRGDMGNTSIDGPRKGGPGPGGARR
Subcellular Location(s) cyto 11.5, cyto_nucl 11.5, nucl 10.5, extr 4
Family & Domain DBs
Amino Acid Sequences MDGSTASSSSALYVPAPLPPAEVLPSVALNGAADLLPRFGLLPLYERAVRPYLPRRRAPPGADGASAQQAHADDAAGDETLPLDGDERRADGEPPVRLLPKTYAHYVEDLPGKVRPPKSKRTQRAPPTGTTMRDIVFRPETTLQRIVPFDDEALRAAFAVRAGDVPEIDASLLEADAEDAGNRRRKKPKRKRGDMGNTSIDGPRKGGPGPGGARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.13
5 0.14
6 0.13
7 0.15
8 0.14
9 0.15
10 0.14
11 0.13
12 0.13
13 0.12
14 0.11
15 0.1
16 0.08
17 0.07
18 0.06
19 0.05
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.08
28 0.08
29 0.11
30 0.11
31 0.15
32 0.17
33 0.17
34 0.2
35 0.21
36 0.21
37 0.25
38 0.34
39 0.4
40 0.46
41 0.52
42 0.54
43 0.6
44 0.66
45 0.62
46 0.58
47 0.55
48 0.5
49 0.44
50 0.39
51 0.32
52 0.3
53 0.27
54 0.21
55 0.14
56 0.12
57 0.11
58 0.11
59 0.09
60 0.05
61 0.05
62 0.06
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.04
71 0.04
72 0.06
73 0.07
74 0.07
75 0.09
76 0.09
77 0.1
78 0.12
79 0.16
80 0.15
81 0.16
82 0.17
83 0.17
84 0.17
85 0.18
86 0.18
87 0.18
88 0.2
89 0.2
90 0.21
91 0.2
92 0.22
93 0.21
94 0.2
95 0.18
96 0.15
97 0.15
98 0.14
99 0.15
100 0.18
101 0.22
102 0.29
103 0.32
104 0.41
105 0.51
106 0.61
107 0.68
108 0.73
109 0.79
110 0.78
111 0.83
112 0.77
113 0.69
114 0.66
115 0.61
116 0.52
117 0.44
118 0.36
119 0.26
120 0.26
121 0.24
122 0.2
123 0.2
124 0.18
125 0.2
126 0.23
127 0.24
128 0.26
129 0.29
130 0.25
131 0.25
132 0.26
133 0.24
134 0.21
135 0.2
136 0.16
137 0.14
138 0.14
139 0.12
140 0.12
141 0.11
142 0.09
143 0.08
144 0.08
145 0.07
146 0.07
147 0.06
148 0.06
149 0.07
150 0.08
151 0.07
152 0.08
153 0.08
154 0.07
155 0.07
156 0.06
157 0.06
158 0.05
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.07
167 0.13
168 0.22
169 0.25
170 0.34
171 0.44
172 0.55
173 0.66
174 0.75
175 0.8
176 0.84
177 0.91
178 0.93
179 0.94
180 0.95
181 0.92
182 0.88
183 0.82
184 0.72
185 0.63
186 0.56
187 0.48
188 0.38
189 0.31
190 0.26
191 0.23
192 0.22
193 0.24
194 0.23
195 0.28