Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316Z2X2

Protein Details
Accession A0A316Z2X2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
178-202ARPAASSRPKNSRRGDRRAKPPDLAHydrophilic
NLS Segment(s)
PositionSequence
183-198SSRPKNSRRGDRRAKP
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR024771  SUZ  
Pfam View protein in Pfam  
PF12752  SUZ  
PROSITE View protein in PROSITE  
PS51673  SUZ  
Amino Acid Sequences MASSPAAGLQSRSRRQAAAASVPDEWDVDEEPATMQPAGPSAFGPATAAPDRPAAAPTAARDSQTWAEAWPAVGSTSSAPLARPGGTWQQQERRLWHDANASAPAAAPIVARVLPPLGAPSLSDSAPPPRILARPPRNAAESAPAPVAPAKSRAQREEEYAQARARIFGPDSSSPNDARPAASSRPKNSRRGDRRAKPPDLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.45
4 0.42
5 0.41
6 0.39
7 0.36
8 0.34
9 0.34
10 0.33
11 0.26
12 0.21
13 0.14
14 0.12
15 0.1
16 0.1
17 0.09
18 0.1
19 0.1
20 0.12
21 0.1
22 0.09
23 0.08
24 0.1
25 0.1
26 0.1
27 0.09
28 0.1
29 0.1
30 0.1
31 0.11
32 0.09
33 0.13
34 0.14
35 0.14
36 0.13
37 0.14
38 0.15
39 0.15
40 0.15
41 0.11
42 0.11
43 0.12
44 0.13
45 0.18
46 0.18
47 0.18
48 0.18
49 0.21
50 0.21
51 0.21
52 0.19
53 0.13
54 0.13
55 0.13
56 0.12
57 0.08
58 0.07
59 0.06
60 0.06
61 0.06
62 0.05
63 0.06
64 0.07
65 0.07
66 0.07
67 0.08
68 0.09
69 0.09
70 0.09
71 0.11
72 0.17
73 0.2
74 0.23
75 0.26
76 0.32
77 0.37
78 0.39
79 0.39
80 0.38
81 0.37
82 0.35
83 0.33
84 0.3
85 0.25
86 0.24
87 0.22
88 0.17
89 0.13
90 0.13
91 0.1
92 0.07
93 0.06
94 0.05
95 0.03
96 0.04
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.05
105 0.05
106 0.05
107 0.08
108 0.09
109 0.09
110 0.1
111 0.1
112 0.14
113 0.16
114 0.16
115 0.14
116 0.15
117 0.17
118 0.21
119 0.31
120 0.35
121 0.41
122 0.44
123 0.46
124 0.46
125 0.45
126 0.42
127 0.37
128 0.3
129 0.24
130 0.21
131 0.18
132 0.16
133 0.17
134 0.18
135 0.12
136 0.16
137 0.18
138 0.25
139 0.3
140 0.32
141 0.37
142 0.37
143 0.42
144 0.42
145 0.44
146 0.41
147 0.39
148 0.37
149 0.34
150 0.32
151 0.28
152 0.24
153 0.21
154 0.19
155 0.18
156 0.23
157 0.24
158 0.27
159 0.29
160 0.31
161 0.3
162 0.3
163 0.32
164 0.27
165 0.24
166 0.24
167 0.25
168 0.3
169 0.39
170 0.44
171 0.48
172 0.58
173 0.63
174 0.69
175 0.74
176 0.77
177 0.78
178 0.81
179 0.85
180 0.84
181 0.89
182 0.9